Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate WP_017549306.1 C792_RS0110000 acetate--CoA ligase
Query= SwissProt::P31638 (660 letters) >NCBI__GCF_000330705.1:WP_017549306.1 Length = 560 Score = 314 bits (805), Expect = 6e-90 Identities = 200/557 (35%), Positives = 301/557 (54%), Gaps = 50/557 (8%) Query: 77 EDGELNASYNCLDRNLQNGNADKVAIVFEADDGSVTRVTYRELHGKVCRFANGLKALGIR 136 E G LN +Y +DR++ +G DK A+ + D ++ T+RE+ K +A LK G Sbjct: 41 ETGRLNIAYETIDRHVDDGRGDKTALHYVNGDERIS-YTFREVKEKTDHYARILKENGAE 99 Query: 137 KGDRVVIYMPMSVEGVVAMQACARLGATHSVVFGGFSAKSLQERLVDVGAVALITADEQM 196 KGDR+ +++P + E +A+ + ++GA + +F F ++++R+ D LIT E + Sbjct: 100 KGDRIFVFLPKTPECYIAILSVIKIGAIAAPLFEAFMEDAIRDRINDCHGSILITDKEMV 159 Query: 197 RGGKALPLKAIADDALALGGCEAVRNVIVYRRTGGKVAWTEGRDRWMEDVSAGQPDTCEA 256 R + ++ + L EA + R+ G EG WME+ Sbjct: 160 RRVPEADIPSL-ETILFAEDIEAAPS-----RSSG-----EGLVEWMEE----------- 197 Query: 257 EPVSAEHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMKWTFDIKPDDLFWCTADIGWV 316 + + + YTSGSTGKPKGV H+ + + KW DIK DD++WCT+ GWV Sbjct: 198 -----DDGMLIHYTSGSTGKPKGVLHAHR-VVSHQYQSGKWVLDIKDDDVYWCTSHPGWV 251 Query: 317 TGHTYIAYGPLAAGATQVVFEGVPTYPNAGRFWDMIARHKVSIFYTAPTAIRSLIKAAEA 376 TG Y + P AT V+ G A ++ +IA KV+I+Y+APTA R L+ + Sbjct: 252 TGSVYGLFAPWLNRATVVIQGG---RFKAEHWYKLIAELKVTIWYSAPTAFRMLLSQGDI 308 Query: 377 DEKIHPKQYDLSSLRLLGTVGEPINPEAWMWYYKNIGNERCPIVDTFWQTETGGHMITPL 436 E YDLSSLR + +VGEP+NPE W ++ +G I DT+W TETG H++ L Sbjct: 309 LEG-----YDLSSLRHILSVGEPLNPEVIYWAWEELGVR---IHDTWWMTETGAHLVVNL 360 Query: 437 PGATPLVPGSCTLPLPGIMAAIVDETGHDVPNGNGGILVVKRPWPAMIRTIWGDPERFRK 496 PG + PGS P PG+ I+DE G+ VP G G L V+ PWP +++ IWG+ ++F Sbjct: 361 PGEK-IKPGSMGRPFPGVEVGILDEAGNVVPRGTTGQLAVRTPWPGLMKEIWGNKDKF-D 418 Query: 497 SYFPEELGGKLYLAGDGSIRDKDTGYFTIMGRIDDVLNVSGHRMGTMEIESALVSNPLVA 556 SYF E YL+GD + +D D Y R DD++N SG R+G E+ES L+ + + Sbjct: 419 SYFKYE---GWYLSGDLAYQD-DEDYVFFQSRDDDMINSSGERIGPFEVESKLIEHEAIQ 474 Query: 557 EAAVVGRPDDMTGEAICAFVVLKRSRPTGEEAVKIATELRNWVGKEIGPIAKPKDIRFGD 616 EA V+G+PD + GE + AF+VL R ++ + E+R +V + PK+I + Sbjct: 475 EAGVIGKPDPVRGEIVKAFIVL---RDGFVQSPDLLEEIRVFVRNNLAAHVAPKEIEVME 531 Query: 617 NLPKTR-SGKIMRRLLR 632 LPKT SGKI+RR L+ Sbjct: 532 ELPKTTISGKILRRELK 548 Lambda K H 0.319 0.136 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1067 Number of extensions: 63 Number of successful extensions: 10 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 660 Length of database: 560 Length adjustment: 37 Effective length of query: 623 Effective length of database: 523 Effective search space: 325829 Effective search space used: 325829 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory