Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_017549807.1 C792_RS0112560 dihydrodipicolinate synthase family protein
Query= BRENDA::A9CFV4 (303 letters) >NCBI__GCF_000330705.1:WP_017549807.1 Length = 293 Score = 138 bits (348), Expect = 1e-37 Identities = 93/291 (31%), Positives = 144/291 (49%), Gaps = 5/291 (1%) Query: 2 KFEGIYTPAITPLGHDGEIDRDAFAAVLESLMEARVHGIIIGGSTGEYYAQTAQERFDLA 61 +FEG + ITP+ D ++ + A ++ ++ + GI+I GSTGE+ + E+ + Sbjct: 4 QFEGAFPVLITPMHGDYSVNYEGMKANVQYYLDQQAAGIVIVGSTGEFASLDEAEKKKIV 63 Query: 62 AYARQVI-GTRLPLVVGTGATRTEDSIEYAKAAKEIGADAILVSSPPYALPTERENAVHA 120 ++ T L+VG RT IEYA+ A+ AD +L+ + Y PTE E Sbjct: 64 ELVGPMVKDTDTALLVGIADERTSKVIEYARHAEANHADGLLLINSFYQTPTEEEAFHQF 123 Query: 121 LAVDRAANLPIMLYNYPARMGVVMGEEYFSRVGKSKNVVA-IKESSGDMGNLHLLARKFP 179 V+ P+M+YN P V + + R+ + + V IKESSGD+ + +A Sbjct: 124 KDVNDVVTQPLMMYNNPFTANVNLEDATICRIDRELDKVQYIKESSGDIRKVRAVADN-T 182 Query: 180 QIALSCGWDDQALEFFAWGAKSWVCAGSNFLPREHVALYEACVVEKNFDKGRAIMTAMLP 239 + L CG DD A E F GA WV +N P LYE K +D+ + + +LP Sbjct: 183 DLVLFCGSDDLAFESFVQGATGWVSVAANIAPNSAAQLYELVKAGK-YDEAKTLNKDLLP 241 Query: 240 LMDFLE-CGKFVQSIKHGCEIIGLRAGSVRAPLRPLNSDEKRTLQTVVTTL 289 L +FLE GK+VQ +K ++ GL G R P L DE L++++ L Sbjct: 242 LCEFLEDSGKYVQIVKKAMDLKGLAGGPSRKPRLGLTDDEVSQLKSLMEKL 292 Lambda K H 0.320 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 293 Length adjustment: 26 Effective length of query: 277 Effective length of database: 267 Effective search space: 73959 Effective search space used: 73959 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory