Align Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 (characterized)
to candidate WP_017548415.1 C792_RS0105320 3-isopropylmalate dehydratase small subunit
Query= SwissProt::Q58667 (170 letters) >NCBI__GCF_000330705.1:WP_017548415.1 Length = 207 Score = 67.0 bits (162), Expect = 2e-16 Identities = 46/132 (34%), Positives = 69/132 (52%), Gaps = 19/132 (14%) Query: 13 DVDTDAIIPGPYLRTTDPYELASHCMAG--IDENFPK---------KVKEGDVIVAGENF 61 +VDTD IIP +L+ + DE+ + K + V++AGENF Sbjct: 18 NVDTDQIIPKQFLKRVERTGFGQFVFHNWRFDEDGNRRDGFELDEAKFEGASVLLAGENF 77 Query: 62 GCGSSREQAVIAIKYCGIKAVIAKSFARIFYRNAINVGLIPIIANTDEI-------KDGD 114 GCGSSRE A A+ G + +IA S+A IFY NA G+I I A+ D++ +DG Sbjct: 78 GCGSSREHAPWALLDYGFRVIIAPSYADIFYNNAFKNGIILIKADEDKVWDWMQKSEDGT 137 Query: 115 I-VEIDLDKEEI 125 + +DL +++I Sbjct: 138 YNIHVDLKQQKI 149 Lambda K H 0.318 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 108 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 207 Length adjustment: 20 Effective length of query: 150 Effective length of database: 187 Effective search space: 28050 Effective search space used: 28050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory