Align Serine hydroxymethyltransferase; SHMT; Serine methylase; L-threonine/L-allo-threonine aldolase; EC 2.1.2.1; EC 4.1.2.48 (characterized)
to candidate WP_034268649.1 AMYHA_RS05585 serine hydroxymethyltransferase
Query= SwissProt::D3DKC4 (427 letters) >NCBI__GCF_000504245.1:WP_034268649.1 Length = 422 Score = 412 bits (1058), Expect = e-119 Identities = 210/404 (51%), Positives = 278/404 (68%), Gaps = 2/404 (0%) Query: 8 DAEIYEAIVKEYERQFYHLELIASENFTSLAVMEAQGSVMTNKYAEGLPHKRYYGGCEFV 67 D EI + E RQ + +IASEN+ S AV+EA G+V+TNKY+EG +RYY G + + Sbjct: 14 DPEIANLVEAEARRQHDKIRMIASENYVSQAVLEATGTVLTNKYSEGYAGRRYYEGQQVI 73 Query: 68 DIAEDLAIERAKALFDAEHANVQPHSGTQANMAVYMAVLKPGDTIMGMDLSHGGHLTHGA 127 D E+L I+RAKA+F +HANVQP+SG+ AN+AVY+A+ KPGDTIMGM L GGHLTHG Sbjct: 74 DQVENLTIDRAKAVFGVDHANVQPYSGSPANLAVYLALAKPGDTIMGMALPDGGHLTHGW 133 Query: 128 KVNFSGKIYNAVYYGVHPETHLIDYDQLYRLAKEHKPKLIVGGASAYPRVIDWAKLREIA 187 V+ +GK +NAV YGV ET +D+DQ+ LA+EH+PKLI G +A PR ID+A EIA Sbjct: 134 TVSATGKWFNAVRYGVRKETGRVDFDQVRELAREHRPKLIFAGGTAIPRTIDFATFAEIA 193 Query: 188 DSVGAYLMVDMAHYAGLIAGGVYPNPVPYAHFVTSTTHKTLRGPRSGFILCKKEFAKDID 247 V A L+ D+AH AGL+AGG +P+PV +A +T+TTHKTLRGPR I+ + E AK ID Sbjct: 194 REVDAVLVADIAHIAGLVAGGAHPSPVGHAPIITTTTHKTLRGPRGAMIMTEAEHAKAID 253 Query: 248 KSVFPGIQGGPLMHVIAAKAVAFKEAMSQEFKEYARQVVANARVLAEEFIKEGFKVVSGG 307 K+VFPG+QGGP AA AVA EA +F++YA VVANA+ LA+ ++ GF +VSGG Sbjct: 254 KAVFPGLQGGPHNSTTAAIAVALGEAAGPDFRDYAHGVVANAKALADALLEHGFDLVSGG 313 Query: 308 TDSHIVLLDLRDTGLTGREVEEALGKANITVNKNAVPFDPLPPVKTSGIRLGTPAMTTRG 367 TD+H++L DL + G+ +AL +A I +N N VPFDP P SGIR+GT A+TTRG Sbjct: 314 TDNHLILADLTSKEIGGKPAAQALDRAGIELNYNTVPFDPRKPFDPSGIRIGTAALTTRG 373 Query: 368 MKEDQMRIIARLISKVIKNI--GDEKVIEYVRQEVIEMCEQFPL 409 ++ + IA I +V+ GDE VI+ V EV E+ FP+ Sbjct: 374 LRPEHQPRIAEWIDRVVTATARGDESVIDTVAAEVGELLANFPM 417 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 422 Length adjustment: 32 Effective length of query: 395 Effective length of database: 390 Effective search space: 154050 Effective search space used: 154050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory