Align Homocitrate synthase AksA; EC 2.3.3.14; (R)-homo(2)citrate synthase; EC 2.3.3.-; (R)-homo(3)citrate synthase; EC 2.3.3.- (uncharacterized)
to candidate WP_034273566.1 AMYHA_RS20250 citramalate synthase
Query= curated2:Q8TW28 (397 letters) >NCBI__GCF_000504245.1:WP_034273566.1 Length = 544 Score = 192 bits (488), Expect = 2e-53 Identities = 133/396 (33%), Positives = 202/396 (51%), Gaps = 20/396 (5%) Query: 15 LPDEVIVYDTTLRDGEQTPGVSFTPEQKLEIAHLLDELGVQQIEAGFPVVSEGERDAVRR 74 L D VYDTTLRDG Q G+S++ KL +A LLDELGV IE G+P + + R Sbjct: 11 LGDTFHVYDTTLRDGAQREGISYSVTDKLAVARLLDELGVGFIEGGWPGALPKDTEFFAR 70 Query: 75 IAHEGL---NADILCLARTLRGDVDAALDCDVDG-------VITFIATSEL-HLKHKLRM 123 + L +A ++ T + A+ D V VIT +A S+ H++ L++ Sbjct: 71 ASSGELALKHAALVAFGATRKAGTTASEDAQVRALLDSNAPVITLVAKSDRRHIERALKV 130 Query: 124 SREEVLERIADTVEYAKDHGLWVAFSAE---DGTRTEFEFLERVYRTAEECGADRVHATD 180 E + DTV + G V AE DG + + RV R + GAD D Sbjct: 131 DVAEACAMVRDTVSFLVSEGRRVFLDAEHFFDGYAFDPDTALRVLRAGADGGADVAVLCD 190 Query: 181 TVGVMIPAAMRLFVAKIREVVDLPIGVHCHDDFGMAVANSLAAVEAGAQAISTTVNGIGE 240 T G +P + V ++ + L +G+HC DD AVANS+AAV+AGA + T NG GE Sbjct: 191 TNGGQLPLGIAETVREVADKTGLRLGIHCQDDTSCAVANSVAAVQAGATHVQCTANGYGE 250 Query: 241 RAGNAALEEVIMALKELYGID--PGFNTEVLAELSRKVSEYSGIDVPPNKAVVGENAFRH 298 RAGNA L VI L +D P L +S ++E + I ++A VG +AF H Sbjct: 251 RAGNADLFAVIGNLVTKLDMDVLPTGGAAELTRVSHALAEIANIAPDTHQAYVGASAFAH 310 Query: 299 ESGIHVAAVLEEPRTYEPIDPKEVGMNRKIVLGKHTGRKAVVAKLEELGVE--PEEEIVE 356 ++G+H +A+ +P Y IDP VG + ++++ + GR ++ K ELGV+ + + Sbjct: 311 KAGLHASAIKVDPLLYNHIDPPVVGNDMRVLVTEMAGRASLELKGRELGVDLASQPTALT 370 Query: 357 EVLKRIKALGDR--RVRVTDSKLEEIVRNVLESRGD 390 V++++KAL + D+ LE ++R ++ GD Sbjct: 371 NVVEKVKALEAKGWSFEAADASLELLLRRAMDDDGD 406 Lambda K H 0.317 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 544 Length adjustment: 33 Effective length of query: 364 Effective length of database: 511 Effective search space: 186004 Effective search space used: 186004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory