Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_034272173.1 AMYHA_RS15990 acetylornithine transaminase
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000504245.1:WP_034272173.1 Length = 393 Score = 301 bits (771), Expect = 2e-86 Identities = 173/371 (46%), Positives = 217/371 (58%), Gaps = 2/371 (0%) Query: 24 YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQT 83 Y L +VRG GA V+DA+GN Y+D VGG V LGH +P VVEAV Q TL Sbjct: 15 YGTPALELVRGDGATVFDADGNAYLDLVGGIAVNALGHAHPAVVEAVSEQVATLGHTSNL 74 Query: 84 LPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGR 143 P+ TL I +V NSG EA EAA+K R TG+ K VA GF GR Sbjct: 75 YINPVALSLAETLLDIAGLS-GKVLFCNSGAEAVEAAIKITRL-TGKSKLVACDGGFHGR 132 Query: 144 TMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPA 203 TMG+LSVT +P REPF PL+ V +P+ D AL+ AVD +TAAV +EPV GEGGV PA Sbjct: 133 TMGALSVTGQPSKREPFEPLLPGVTHVPFGDTAALESAVDGDTAAVFVEPVLGEGGVVPA 192 Query: 204 TPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLG 263 FLRAAREI GALL+LDE+QTG+GR G FAF+ G+ PD++TLAK LGGG+PLG Sbjct: 193 PDGFLRAAREIATAAGALLVLDEVQTGIGRLGSWFAFQQAGVTPDVITLAKGLGGGLPLG 252 Query: 264 VAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRA 323 + + + G HGTTFGGNP+A AAG A IR + L + LG +R Sbjct: 253 AVIGIGQTGELLKPGQHGTTFGGNPIACAAGHAVIRTIREQGLLDHVETLGKDLAAGVRK 312 Query: 324 IPSPKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDL 383 + P + EVRG GL+ G+ L + AP +A + L P VIR PPL+I + + Sbjct: 313 LDHPLVSEVRGAGLLQGIGLTKPVAPTVATAAQRAGYLINPVQPDVIRLAPPLIITERQV 372 Query: 384 ERVVEAVRAVL 394 + A+ A L Sbjct: 373 ADFLAALPAAL 383 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 393 Length adjustment: 31 Effective length of query: 364 Effective length of database: 362 Effective search space: 131768 Effective search space used: 131768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory