Align histidinol-phosphatase (EC 3.1.3.15) (characterized)
to candidate WP_037571962.1 BS73_RS12985 inositol monophosphatase
Query= BRENDA::Q8NS79 (273 letters) >NCBI__GCF_000744815.1:WP_037571962.1 Length = 269 Score = 102 bits (254), Expect = 9e-27 Identities = 81/266 (30%), Positives = 123/266 (46%), Gaps = 22/266 (8%) Query: 18 DEHLAQALVYNAGRLAWRMRENGVDTDY-----KTSVSDVVTDADRAAEAFVAGVLEALR 72 DE LA AL AGR A + +G D K+S DVVT+ D A+E + ++ A R Sbjct: 10 DELLALAL--EAGRRAGALLRDGRPDDLGVAATKSSPVDVVTEMDLASEKLITELIAARR 67 Query: 73 PEDGVLGEEGADRASKSGKTWVIDPVDGTYNFTQGSDYWCSALALVEGDPSAPSRVLFGA 132 P+DG+LGEEGA SG WVIDP+DGT N+ G W ++A R + G Sbjct: 68 PDDGLLGEEGASSTGTSGVRWVIDPLDGTVNYLYGLPCWAVSIA-----AEWQGRTVVGV 122 Query: 133 VHRPAMGYTWFGGPGIRTTLDGKELDLLVDAPLNQISLAT---YIHPSRIAEPDIQKAWM 189 V P+ G T G ++G+ PL + + T Y+ R + + + Sbjct: 123 VEVPSRGETVEAVLGRGAQVNGRPAHCRPSPPLERALIGTGFGYLRERRERQAAVVQ--- 179 Query: 190 SVATHPATLRMFGAGSIDLANIADGSIGAWVQHSVADWDWLPGRALIEGVGGACIKVTAG 249 + +R G+ +IDL+++ G + + + + WD+ G ALI GA I G Sbjct: 180 QLIPRVRDIRRAGSAAIDLSDVGLGRLDGFYERGLNPWDYAAG-ALIASEAGASIGGRPG 238 Query: 250 GV---EWSVAGNAEAVSEISETLSAL 272 + +VA + + +TL AL Sbjct: 239 DAPSPDLTVAASPGLFPVLQQTLDAL 264 Lambda K H 0.316 0.133 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 269 Length adjustment: 25 Effective length of query: 248 Effective length of database: 244 Effective search space: 60512 Effective search space used: 60512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory