Align 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 (characterized)
to candidate WP_037572524.1 BS73_RS14590 3-isopropylmalate dehydratase small subunit
Query= SwissProt::Q8NQV7 (197 letters) >NCBI__GCF_000744815.1:WP_037572524.1 Length = 198 Score = 242 bits (618), Expect = 3e-69 Identities = 126/195 (64%), Positives = 146/195 (74%), Gaps = 1/195 (0%) Query: 1 MEKFTTYTGVGVPLQRSNVDTDQIIPAVYLKRVTRTGFEDGLFSNWRQNDPNFVLNTDTY 60 MEKFT +TG VPL+RSNVDTDQIIPA +LK+VTRTGFEDGLF WR+ D +FVLN Sbjct: 1 MEKFTVHTGRAVPLRRSNVDTDQIIPAHWLKKVTRTGFEDGLFEAWRK-DESFVLNDPVR 59 Query: 61 KNGSVLVAGPDFGTGSSREHAVWALMDYGFRAVFSSRFADIFRGNSGKAGMLTGIMEQSD 120 K +VLVAGPDFGTGSSREHAVWAL +YGF+AV S RFADIFRGNS K G+LT I+ Sbjct: 60 KGATVLVAGPDFGTGSSREHAVWALQNYGFKAVISPRFADIFRGNSLKNGLLTVILPAET 119 Query: 121 IELLWKLMEQTPGLELTVNLEKQIVTAGDVVISFEVDPYIRWRLMEGLDDAGLTLRKLDE 180 +E L L+E P E+TV+LE + V A V SFE+D RWRL+ GLDD +TL + D Sbjct: 120 VEALQALVEADPQAEITVDLENREVRAQGVTASFELDENARWRLLNGLDDISITLDQEDA 179 Query: 181 IEDYEAKRPAFKPRT 195 I YEAKRPAFKPRT Sbjct: 180 IAAYEAKRPAFKPRT 194 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 197 Length of database: 198 Length adjustment: 20 Effective length of query: 177 Effective length of database: 178 Effective search space: 31506 Effective search space used: 31506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_037572524.1 BS73_RS14590 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00171.hmm # target sequence database: /tmp/gapView.3195086.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00171 [M=188] Accession: TIGR00171 Description: leuD: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-63 198.6 0.0 5.2e-63 198.4 0.0 1.1 1 NCBI__GCF_000744815.1:WP_037572524.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000744815.1:WP_037572524.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 198.4 0.0 5.2e-63 5.2e-63 1 188 [] 1 180 [. 1 180 [. 0.97 Alignments for each domain: == domain 1 score: 198.4 bits; conditional E-value: 5.2e-63 TIGR00171 1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewryldekGkepnpefvlnvpqyqgasil 73 m++f +tG +vpl + nvdtd+iip +lkk++rtGf+ lf wr + fvln p+ +ga++l NCBI__GCF_000744815.1:WP_037572524.1 1 MEKFTVHTGRAVPLRRSNVDTDQIIPAHWLKKVTRTGFEDGLFEAWRK--------DESFVLNDPVRKGATVL 65 899********************************************7........456************** PP TIGR00171 74 larenfGcGssrehapwalkdyGfkviiapsfadifynnsfkngllpirlseeeveellalvk.nkglkltvd 145 +a+ +fG Gssreha wal++yGfk +i+p fadif +ns+kngll + l+ e+ve l alv+ ++ ++tvd NCBI__GCF_000744815.1:WP_037572524.1 66 VAGPDFGTGSSREHAVWALQNYGFKAVISPRFADIFRGNSLKNGLLTVILPAETVEALQALVEaDPQAEITVD 138 **************************************************************989999***** PP TIGR00171 146 leaqkvkdsegkvysfeidefrkhcllnGldeigltlqkedei 188 le+++v++ g + sfe+de + llnGld+i++tl +ed+i NCBI__GCF_000744815.1:WP_037572524.1 139 LENREVRAQ-GVTASFELDENARWRLLNGLDDISITLDQEDAI 180 ******975.69*****************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (188 nodes) Target sequences: 1 (198 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.76 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory