Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate WP_037575899.1 BS73_RS24325 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q8TQ40 (389 letters) >NCBI__GCF_000744815.1:WP_037575899.1 Length = 398 Score = 177 bits (449), Expect = 5e-49 Identities = 117/370 (31%), Positives = 178/370 (48%), Gaps = 7/370 (1%) Query: 24 AKDEMIAKGVDVIDLGVGDPDLPTHPHIVEAMREAVCDPKTHQYPSYAGMPEFREAAAEW 83 A+ +A I+LG G PD + EA A+ + + +QYP G+PE R A AE Sbjct: 30 AEMSALATTTGAINLGQGFPDTDGPEAVREAAVRALREGRGNQYPPGPGVPELRAAVAEH 89 Query: 84 CKKYKGIELDPATEVLSLIGSKEAVAHIPLAFVNPGDVVLYTDPGYPVYKIGTLFAGGEP 143 ++ G++ DP TEVL G+ EA+A LA + PGD V+ +P Y Y AG + Sbjct: 90 QLRFYGLDFDPDTEVLVTAGATEAIAASMLALLEPGDEVIAFEPFYDSYAACIAMAGAKR 149 Query: 144 YSLPLKAENSFLPDLDSIPADILKRAKLFFFNYPNNPTSATADMKFFEKVVEFCKKNDII 203 L+A SF PDLD + A I +L N P+NPT D + + ++D++ Sbjct: 150 VPFTLRAP-SFRPDLDELRALITPSTRLLLLNSPHNPTGMVLDDEELRAIAALAVEHDLL 208 Query: 204 AVHDNAYSQMVYDGYDAPSFLAAEGAMDIGIELYSHSKTYNMTGWRLGFAVGSKALIKGL 263 V D Y +V++G P A G + + + S KT++ TGW++G+ + L+ + Sbjct: 209 VVTDEVYEHLVFEGAHRP-IAALPGMRERTVSISSAGKTFSFTGWKVGWVTAAAPLVAAV 267 Query: 264 GKVKSNVDSGVFDAIQIAGIAALSSSQACVDDTNKIYEERRNVLIEGLTAMGLEVKPPKA 323 K + Q A AL A +D RR++L GL A G EV P+ Sbjct: 268 RTAKQYLTYVSAGPFQYAVAEALRLPDAYYEDFRASLRRRRDLLDAGLRAAGFEVYEPQG 327 Query: 324 TFYVWAPV-PTGF-TSIEFAKLLLEEAGIVATPGVGFGD---AGEGYVRFALTKPVERIK 378 T+++ + P G + F + L E G+VA P F D AG VRF K E ++ Sbjct: 328 TYFITTDIAPFGAKDAYAFCRSLPERCGVVAVPNSVFYDDPEAGRSQVRFTFCKKEEVLR 387 Query: 379 EAVERMKKLQ 388 EA R+++L+ Sbjct: 388 EAAARLQRLR 397 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 398 Length adjustment: 31 Effective length of query: 358 Effective length of database: 367 Effective search space: 131386 Effective search space used: 131386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory