Align [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 (uncharacterized)
to candidate WP_037574263.1 BS73_RS19430 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Query= curated2:Q9RW75 (429 letters) >NCBI__GCF_000744815.1:WP_037574263.1 Length = 425 Score = 231 bits (589), Expect = 3e-65 Identities = 151/398 (37%), Positives = 210/398 (52%), Gaps = 39/398 (9%) Query: 28 VVMVRGQGATVWDENGRSYIDCVVGYGVATLGHSHPDVVKAVQEQAGKLMVMPQTVPNDK 87 V+ RG+G +++E+GR ++D G GV + GH HP VV A QEQ G+L+ T K Sbjct: 14 VLAERGEGVYLYEESGRRHLDFTAGIGVTSTGHCHPKVVAAAQEQVGRLVHGQYTTVMHK 73 Query: 88 RAEFLQELVG-VLPQGLDRVFLCNSGTEAMEAAKKFAITATGRSRFVSMKRGFSGRSLGA 146 L E +G VLP GLD +F NSG+EA+EAA + A AT R V + F GR+L A Sbjct: 74 PLLTLSERLGEVLPAGLDSLFFVNSGSEAVEAAMRLAKQATARPNIVVFQGSFHGRTLAA 133 Query: 147 LSFTWEP-KYREPFGDAVDNKSV-------DFVTYG------------NLDELRAAVTE- 185 S T K+R +G + ++ + YG LDEL A V+ Sbjct: 134 ASMTTSATKFRSGYGPLMPGVAIAPFPHAAHYARYGMDEEAATRFALRELDELLATVSAP 193 Query: 186 -QTAAVIMEPVQGEGGVRPASAEFIQEARRITREKGALLILDEIQTGFCRTGKMFACEHF 244 TAA I+EPV GEGG PA++ F++ R G LLILDE+QTGF RTG+ + +HF Sbjct: 194 ADTAAFIVEPVLGEGGYVPANSAFLRGLRERADRHGILLILDEVQTGFGRTGRFWGHDHF 253 Query: 245 GVIPDGMTLAKAIAGGTPTAAFAMMSEVADRMPAGGHGTTFGGNPLSMAAGVASLRAMKR 304 PD + AK +A G P +A A + ++ G G T+GGN ++ AA +A+L ++ Sbjct: 254 DGRPDILVTAKGLASGFPLSAIAAPRALMEKAWPGSQGGTYGGNAVACAAAIATLDVIQE 313 Query: 305 EGLAEQAREKGAYMMDKLRAIQSPK-------IREVRGLGLMIGVELKE-------KSAP 350 E L E A E+G + LR + + I +VRGLGLM G E +A Sbjct: 314 EKLVENAAERGEQLFAGLREVAAAHPAGGRGGIGDVRGLGLMAGTEFTTADGEPDGATAA 373 Query: 351 YIHAMEHDEGVLCLAATPL--VVRFLPPAVISKEQIDQ 386 +HA + G+L L P VVR +PP V+ EQID+ Sbjct: 374 KVHAAAAERGLLLLTCGPRGEVVRMIPPLVVDAEQIDE 411 Lambda K H 0.317 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 425 Length adjustment: 32 Effective length of query: 397 Effective length of database: 393 Effective search space: 156021 Effective search space used: 156021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory