Align D-3-phosphoglycerate dehydrogenase (characterized, see rationale)
to candidate WP_037574474.1 BS73_RS20125 D-2-hydroxyacid dehydrogenase family protein
Query= uniprot:Q5JGC4 (304 letters) >NCBI__GCF_000744815.1:WP_037574474.1 Length = 324 Score = 173 bits (439), Expect = 4e-48 Identities = 111/280 (39%), Positives = 154/280 (55%), Gaps = 5/280 (1%) Query: 27 EEYPDEDRLVELVKDVDAII-VRSKPKVTRKVIEAAPKLKVIGRAGVGLDNIDLKAAEER 85 E D+D L E + A+I +R + +++ P+L+++ G +ID+ AA R Sbjct: 42 EHLSDQDALAERLAPYQAVIAMRERTPFPAELLARLPELRLLVTTGQANASIDVAAARAR 101 Query: 86 GIKVVNSPGASSRSVAELAIGLIFAVARKIAFADRKMREGVWAKKQCMGIELEGKTIGVV 145 G+ V + S + AEL LI +AR D +R G W + +G L+G+T+GV+ Sbjct: 102 GVTVCGTR-MSRYAAAELTWALILELARGAGAQDASLRSGGW--QAGVGTGLDGRTLGVI 158 Query: 146 GFGRIGYQVAKIANALGMKVLFYDPYPNEERAKEVGGK-FADLETLLKESDVVTLHVPLV 204 G GR+G +VA I A GM+VL + + ERA E G A E LL+ SDVV+LH+ L Sbjct: 159 GLGRLGSRVASIGAAFGMEVLAWTRHMTPERAAEAGATPVASREELLERSDVVSLHLRLN 218 Query: 205 DATYHLINEERLKLMKPTAILINAARGAVVDTDALVKALQEGWIAGAGLDVFEEEPLPAD 264 T +I L MKPTA L+N +RG +VD AL AL+ G I GAGLDV++ EPLPA Sbjct: 219 AETRGIIGAAELARMKPTAWLVNTSRGPLVDEAALASALRAGTIGGAGLDVYDIEPLPAG 278 Query: 265 HPLTKLDNVVLTPHIGASTVEAQMRAGVEVAEKIVEALKG 304 PL N VLTPHIG T + A + AE + L G Sbjct: 279 SPLLDAPNTVLTPHIGYVTADCFELAYGDAAEDVTAWLAG 318 Lambda K H 0.317 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 324 Length adjustment: 27 Effective length of query: 277 Effective length of database: 297 Effective search space: 82269 Effective search space used: 82269 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory