Align prephenate dehydratase (EC 4.2.1.51) (characterized)
to candidate WP_059152706.1 V474_RS17425 prephenate dehydratase
Query= BRENDA::Q5NLV8 (337 letters) >NCBI__GCF_001046635.1:WP_059152706.1 Length = 299 Score = 288 bits (737), Expect = 1e-82 Identities = 162/304 (53%), Positives = 200/304 (65%), Gaps = 7/304 (2%) Query: 34 MDDYSASAKALVAEMQAKAALSPTKAVAFQGAPGCNSNIAIQDLFPDSLPLPCFSFADAL 93 M+ Y A ALV EM+ A SP +AVA QGAPGCN + A + D LPLPCFSF DAL Sbjct: 1 MNAYPQPAIALVGEMEVAALASPERAVALQGAPGCNGHRAALEYDADCLPLPCFSFEDAL 60 Query: 94 TAVKEGRAGRAMIPIENSLNGRVADMHFLLPESGLTIQAEYFLPINHCLVAPKGA-GEIT 152 AVKEGRA RA+IPIENS +GRVAD+HFLLPESGL+I E+F+ I+H L+A GA G + Sbjct: 61 DAVKEGRAARAIIPIENSQHGRVADIHFLLPESGLSIVGEHFMSIHHALMALPGAKGPFS 120 Query: 153 HVLSHPQALGQCRHWLQAHNLRALAHADTAGAAAEVADRKQAGLAALSPALAAKLYGLEI 212 SHPQALGQ RH+L+ + +A+ADTAGAAA V + A++P LAA+LYGL++ Sbjct: 121 AAYSHPQALGQSRHYLRERGIVPMAYADTAGAAALVREAGDPNSCAIAPKLAAQLYGLDV 180 Query: 213 LEKGIADGDTNITRFVVLAEADTALQDLPPIRQNLSGKMMTSLLFTVKNTPSALLNAIKG 272 +E+ + D N TRFVVLA + L P MT+ +F VKN P+AL A+ G Sbjct: 181 IEENVEDAADNTTRFVVLAR-----EPLDPFELK-DQPAMTTFIFEVKNIPAALYKALGG 234 Query: 273 FGDNQVNMTKLESYQHGASFSATQFYADVEGEPSEDNVARALDILQENACDLRILGVYAQ 332 F N VNMTKLESYQ ASF+AT FYAD+EG P E V AL L + +R LG Y + Sbjct: 235 FATNGVNMTKLESYQAQASFAATTFYADIEGAPGEARVDMALQELAFHCKYVRPLGTYRR 294 Query: 333 ARPR 336 AR R Sbjct: 295 ARAR 298 Lambda K H 0.318 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 299 Length adjustment: 27 Effective length of query: 310 Effective length of database: 272 Effective search space: 84320 Effective search space used: 84320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory