Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate WP_059152017.1 V474_RS13815 aspartate aminotransferase family protein
Query= reanno::azobra:AZOBR_RS19025 (389 letters) >NCBI__GCF_001046635.1:WP_059152017.1 Length = 396 Score = 397 bits (1021), Expect = e-115 Identities = 210/385 (54%), Positives = 263/385 (68%), Gaps = 1/385 (0%) Query: 2 IPVVMPTYARADIVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHK 61 I +MP Y R + RGE +L + DGRRFLDFA+G+AVN LGH++P L+ A+ QA Sbjct: 3 ITPLMPVYPRCGVRPVRGEHCHLVSEDGRRFLDFASGIAVNALGHSHPGLIGAIQKQAET 62 Query: 62 LWHTSNLFRVAGQESLAKRLTEATFADTVFFTNSGAEAWECGAKLIRKYHYEKGDKARTR 121 L H SNL+ E++A+RL + TFADTVFFTNSGAEA EC K R YH G++ + Sbjct: 63 LMHVSNLYGSPQGEAVAQRLVDLTFADTVFFTNSGAEAVECAIKTARAYHQSAGNEDKFE 122 Query: 122 IITFEQAFHGRTLAAVSAAQQEKLIKGFGPLLDGFDLVPFGDLEAVRNAVTDETAGICLE 181 +ITF AFHGRTLA +SA+ QEK+ KGF PLL GF V F DLEA + A+ TAG +E Sbjct: 123 LITFNNAFHGRTLATISASSQEKMHKGFLPLLPGFKYVEFNDLEAAKAAIGPNTAGFLVE 182 Query: 182 PIQGEGGIRAGSVEFLRGLREICDEHGLLLFLDEIQCGMGRTGKLFAHEWAGITPDVMAV 241 PIQGEGGIR + EFL GLR +CDEH L+L LDE+Q G+GR G L+A+E GITPD+MA Sbjct: 183 PIQGEGGIRIATDEFLGGLRALCDEHDLMLVLDEVQSGVGRAGTLYAYEQYGITPDIMAT 242 Query: 242 AKGIGGGFPLGACLATEKAASGMTAGTHGSTYGGNPLATAVGNAVLDKVLEPGFLDHVQR 301 AKGIGGGFP+GACLATEKAA GM AGTHGSTYGGNP A A AVLD + E F+ V+ Sbjct: 243 AKGIGGGFPVGACLATEKAARGMVAGTHGSTYGGNPFAMAAIGAVLDVMSEETFMADVRA 302 Query: 302 IGGLLQDRLAGLVAENPAVFKGVRGKGLMLGLACGPAVGDVVVALRAN-GLLSVPAGDNV 360 G L+ RL + P +F+ VRG+GL +GL V +R N LL+V AGDNV Sbjct: 303 KGERLKARLEQFIGNYPDLFELVRGRGLFIGLKMKVEPRPFVAHMRDNHQLLTVSAGDNV 362 Query: 361 VRLLPPLNIGEAEVEEAVAILAKTA 385 VR++PPL I ++ ++E + L+ A Sbjct: 363 VRIIPPLVIDDSHIDEFMEKLSAAA 387 Lambda K H 0.321 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 456 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 396 Length adjustment: 31 Effective length of query: 358 Effective length of database: 365 Effective search space: 130670 Effective search space used: 130670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory