GapMind for Amino acid biosynthesis

 

Alignments for a candidate for lysZ in Novosphingobium barchaimii LL02

Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate WP_059151633.1 V474_RS11450 glutamate 5-kinase

Query= curated2:B1YB53
         (260 letters)



>NCBI__GCF_001046635.1:WP_059151633.1
          Length = 382

 Score = 51.2 bits (121), Expect = 3e-11
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 12/101 (11%)

Query: 164 DGDQLAFDVAKRLGAERLVLLSDVDGL------IIGGSVVPRLTAAQAE-ELVKNEEVR- 215
           D D+LA  VA+  GA  +VLLSD+DGL      + G  ++P +    AE + + + E   
Sbjct: 159 DNDRLAARVAQAAGASAVVLLSDIDGLYDRHPKLPGAQMIPVVEGVTAEVQAMASTESNS 218

Query: 216 ----GGMKRKLLMAAEAAKLGLEVVISNGLVDKPIDAALSG 252
               GGM  KL  A  A   G+ +VI NG  D+P++  ++G
Sbjct: 219 GMGSGGMVSKLQAAEIAQLAGICLVIGNGQHDRPVERIVTG 259


Lambda     K      H
   0.319    0.139    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 275
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 260
Length of database: 382
Length adjustment: 27
Effective length of query: 233
Effective length of database: 355
Effective search space:    82715
Effective search space used:    82715
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory