Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_055436832.1 ASC41_RS11700 ornithine--oxo-acid transaminase
Query= BRENDA::O30508 (406 letters) >NCBI__GCF_001418085.1:WP_055436832.1 Length = 426 Score = 224 bits (570), Expect = 5e-63 Identities = 130/394 (32%), Positives = 206/394 (52%), Gaps = 18/394 (4%) Query: 14 DRYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQR 73 ++Y NY P + RGEG VWD G++ DF + + GH HP +++A+T QA+ Sbjct: 17 NKYGAHNYHPLPVVLSRGEGVYVWDVEGKKYYDFLSAYSAVNQGHCHPRIIEAMTNQAKT 76 Query: 74 IWHVSNVFTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYG--PQK 131 + S F N+ + + + +++ N+GAEA E A KL R++A +V G + Sbjct: 77 LTLTSRAFYNDMLGKFEKYATETFGFDKLLPMNTGAEAVETALKLCRKWAYEVKGIDENE 136 Query: 132 YEIIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAIS--DKTCA 189 EII N+FHGRT ++ P FGP +G + YN+L+AL+ A+S + Sbjct: 137 AEIIVCENNFHGRTTTIISFSNDPVARKNFGPYTKGFIKIEYNNLKALEEALSSNNNIAG 196 Query: 190 VVLEPIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAY-------- 241 ++EPIQGE GV + YL A+ LC+++N L + DEVQ+G+ R G L A Sbjct: 197 FLVEPIQGEAGVYVPTEGYLAAAKALCEKYNVLFIADEVQTGIARTGRLLATCGNCTCAD 256 Query: 242 MHYGVVP----DILSSAKSL-GGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAE 296 H P DIL K+L GG +P+ A+L I + G HG+T+GGNP+A+A+ Sbjct: 257 KHCSGTPEVKADILILGKALSGGAYPVSAVLANNAIMDVIKPGNHGSTFGGNPVAAAIGM 316 Query: 297 AALDVINTPEVLDGVKAKHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTD-EWKGKAR 355 AAL+VI + + + E F++ + K + I + +RG GLL + D E A Sbjct: 317 AALEVIKDENLAENAQVLGELFRAEIAKFIETSNIVNGVRGKGLLNAILINDTEDSDTAW 376 Query: 356 DVLNAAEKEAVMVLQASPDVVRFAPSLVIDDAEI 389 ++ A ++ +++RFAP LV+ ++ Sbjct: 377 NICMALRDNGLLAKPTHGNIIRFAPPLVMTKEQL 410 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 426 Length adjustment: 31 Effective length of query: 375 Effective length of database: 395 Effective search space: 148125 Effective search space used: 148125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory