Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate WP_055435113.1 ASC41_RS02715 cysteine synthase CysM
Query= metacyc::MONOMER-20568 (299 letters) >NCBI__GCF_001418085.1:WP_055435113.1 Length = 292 Score = 266 bits (679), Expect = 5e-76 Identities = 138/293 (47%), Positives = 192/293 (65%), Gaps = 2/293 (0%) Query: 5 NILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKLHPGS 64 +IL+ IGNTPLV ++L P V++Y KLEG NP GSVKDR A MI +A G + G Sbjct: 2 SILKQIGNTPLVEASNLVSKPNVKLYLKLEGNNPGGSVKDRPAYNMIAEAVKRGDIEKGG 61 Query: 65 TIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILTDKKLGTDGA 124 I+EATSGNTGI LA + + G + +VM E ++ER K ++A+GAE+ILT + G +G+ Sbjct: 62 HIVEATSGNTGIALAYVASLFGIKISLVMPENSTVERIKTMRAYGAEVILTSAERGIEGS 121 Query: 125 IRKVAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAAVGTSGTLM 184 R VA +++ G Y NQF N+ N AHYKTT EIW T G VTHFV+A+GT+GT+M Sbjct: 122 -RDVAFKMRDEKG-YLLLNQFENDDNWKAHYKTTGPEIWRDTNGEVTHFVSAMGTTGTIM 179 Query: 185 GVGKNLREKNPEIKIIEAQPTKGHYIQGLKSMEEAIVPAIYQADKIDEHILIESEEAFAK 244 G L+E+N I+II AQP G I G++ VP+I+ K+D+ I + E+A A Sbjct: 180 GTSTFLKEQNKNIQIIGAQPMDGSRIPGIRKWSPDYVPSIFNPSKVDQVIEVSQEQATAM 239 Query: 245 AREIVAQEGIFIGMSSGAAMLAAQKLAEKIDSGVIVVLFADRGEKYLSTKLFD 297 + + +EG+F GMSSG ++ A KL E ID+G++V + DRG++YLS+ LFD Sbjct: 240 TKRLAREEGVFAGMSSGGSVATALKLIETIDTGIVVAIICDRGDRYLSSALFD 292 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 292 Length adjustment: 26 Effective length of query: 273 Effective length of database: 266 Effective search space: 72618 Effective search space used: 72618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory