Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate WP_055435184.1 ASC41_RS03100 pyridoxal-phosphate dependent enzyme
Query= metacyc::MONOMER-20568 (299 letters) >NCBI__GCF_001418085.1:WP_055435184.1 Length = 326 Score = 215 bits (548), Expect = 1e-60 Identities = 128/314 (40%), Positives = 183/314 (58%), Gaps = 19/314 (6%) Query: 4 DNILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKLHPG 63 +NIL TIGNTPLV+IN L + +K E FNP SVKDR+AL+MIE AEA+G+L PG Sbjct: 5 ENILGTIGNTPLVKINKLTAELPCLVLSKYETFNPGNSVKDRMALQMIEDAEADGRLKPG 64 Query: 64 STIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILTDKKLGTDG 123 TIIE TSGNTG+GLA+ +KGY I VM++ S E+ ++KA GAE+++ + + Sbjct: 65 GTIIEGTSGNTGMGLALAAIIKGYKCIFVMADKQSKEKVDILKAVGAEVVVCPTAVDPED 124 Query: 124 --AIRKVAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAAVGTSG 181 + V++ + E + NQ+ N N AHY++T EIW QT G +THFV VGT G Sbjct: 125 PRSYYSVSKRLGEETPNSWYVNQYDNPSNAKAHYQSTGPEIWEQTDGKITHFVVGVGTGG 184 Query: 182 TLMGVGKNLREKNPEIKI----IEAQPTKGHYIQGL-----------KSMEEAIVPAIYQ 226 T+ GVGK L+E+NP IKI K ++ G+ + + E I+P Sbjct: 185 TISGVGKYLKEQNPNIKIWGIDTYGSVFKKYHETGIFDEKEIYPYVTEGIGEDILPKNVD 244 Query: 227 ADKIDEHILIESEEAFAKAREIVAQEGIFIGMSSGAAMLAAQKLAEKI-DSGVIVVLFAD 285 D ID + ++A + + +EG+F+G S+GAA+ +L E V+VVLF D Sbjct: 245 FDIIDGFTKVTDKDAAVYTQRLSKEEGMFLGNSAGAAIKGVLQLKEHFTKDDVVVVLFHD 304 Query: 286 RGEKYLSTKLFDTE 299 G +Y+ K+F+ E Sbjct: 305 HGSRYVG-KMFNDE 317 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 326 Length adjustment: 27 Effective length of query: 272 Effective length of database: 299 Effective search space: 81328 Effective search space used: 81328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory