Align prephenate and/or arogenate dehydratase (EC 4.2.1.51) (characterized)
to candidate WP_055435118.1 ASC41_RS02740 prephenate dehydratase
Query= reanno::Cola:Echvi_0123 (279 letters) >NCBI__GCF_001418085.1:WP_055435118.1 Length = 275 Score = 287 bits (735), Expect = 2e-82 Identities = 142/270 (52%), Positives = 193/270 (71%) Query: 10 VAIQGIKGSYHYQVALNQFGQDIHVIECLTFSDLVKSITSNDADIGVLALENSIAGAILP 69 VAIQGIKGS+H+ V+ + FG D V ECL+F + V ++ S ++ ++ALENSIAG+I+P Sbjct: 5 VAIQGIKGSFHHIVSQDYFGADTAVNECLSFDETVDALLSGKTEVAIMALENSIAGSIIP 64 Query: 70 NYDLMDRNNLQVIGEFYLPISHQLMVLKGQSIDDITEVRSHPMALLQCKAFFEQYPQIKL 129 NY L+D NNL ++GE+YL I H LM L QSI+DI EV SHPMALLQCKAFF+ YP IKL Sbjct: 65 NYALIDNNNLHIVGEYYLDIQHNLMALPNQSIEDIKEVHSHPMALLQCKAFFKNYPHIKL 124 Query: 130 IEDLDTASVAKEISEQHLQGVGAIAGKSAAEFYGLDILASDIQTIKNNITRFCIVKNAAD 189 +ED DTA VAK I +++L+G+ A+A AA + L+I+A IQTIK+N TRF IVK Sbjct: 125 VEDKDTADVAKRIQDKNLKGIAAVASSLAASIFELNIIAESIQTIKHNETRFVIVKQNNS 184 Query: 190 AKPVIGFDKASIKVTIKNEQGSLAKVLTTMSAYRLDLTKIQSLPVIDQPWHYAFFIDLLF 249 +KASIK + +++GSLA +L +S +L+LTKIQSLP I+ PW YAFF+D+ F Sbjct: 185 EINTNEINKASIKFELDHKRGSLAAILNVLSDCKLNLTKIQSLPKIETPWLYAFFVDVTF 244 Query: 250 ENLEDYQQALKELKANGHQIKVLGEYKNTK 279 ++ +D+ +A ++ +KVLGEYKN K Sbjct: 245 DDYKDFDKAKAVIEIMATHLKVLGEYKNAK 274 Lambda K H 0.319 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 275 Length adjustment: 25 Effective length of query: 254 Effective length of database: 250 Effective search space: 63500 Effective search space used: 63500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory