Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate WP_055435532.1 ASC41_RS04930 aspartate aminotransferase family protein
Query= metacyc::MONOMER-18314 (387 letters) >NCBI__GCF_001418085.1:WP_055435532.1 Length = 394 Score = 218 bits (554), Expect = 3e-61 Identities = 125/380 (32%), Positives = 210/380 (55%), Gaps = 16/380 (4%) Query: 12 LTIVKGEAQYVWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLE---NISILSTSFS 68 + I + Y++D + YLDF G+ LGH +P ++ +K Q++ ++ + Sbjct: 19 MEISHAKGSYIYDTNNKVYLDFVAGVSACPLGHSHPRVVSAIKTQIDKYLHVMVYGEYIQ 78 Query: 69 TPIKDEMLQALDKVKPDKMDNAMLLNSGTEAVEAALKTARKITGRKKIIAFKNAFHGRTA 128 P D + + L K P ++ L+NSGTEA+E ALK AR+ TGR +IIA +A+HG T Sbjct: 79 KPAVD-LCELLAKNLPFPLEKTYLVNSGTEAIEGALKLARRATGRSEIIAAHSAYHGNTM 137 Query: 129 GSLSVTWNKKYREPFEPLVGPVEFLTFNNIEDLSKIDNETAAVIVEPIQGESGVIPANIE 188 GSLS+ ++ + PF PL+ + +TFNN L I +TA VI+E IQG +G I + Sbjct: 138 GSLSLMDFEERKAPFRPLLPEISHITFNNEAHLKHITTKTACVILETIQGGAGFIEPKND 197 Query: 189 FMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAYKHYNIVPDILTAGKAIGGGFPVSVVF 248 +++ ++E+ + G+LLI DEIQ G GRTGKL+ +++YN +PDIL GK +GGG P+ Sbjct: 198 YLQKVRERCNDVGALLILDEIQPGIGRTGKLFGFENYNCIPDILVTGKGLGGGLPIGAFT 257 Query: 249 LPDHIANKLEEG---DHGSTYGGNPMAMAAVTAACKVIEKENVVEQANQKGQQFSNILVK 305 + L++ H +T+GGNP+ +A A + I + +++ Q +K + L++ Sbjct: 258 ASTKLMETLQDNPKLGHITTFGGNPVIASAALATLQEITESDLMSQTLEKEK-----LIR 312 Query: 306 NLADLKVVREVRGKGLMIGIDIRFQP--GQVLKYLQEKGILA--VKAGSTVIRFLPSYLI 361 + ++ E+RGKGLM+ + Q++ Q+ G++ + IR P I Sbjct: 313 SHLKHPLINEIRGKGLMLAAILPSAEIVNQLILKSQDNGLILFWLLFEPKAIRITPPLTI 372 Query: 362 TYENMEEASNVLREGLLKIE 381 + E + + ++ E L I+ Sbjct: 373 SNEEIIKGCGIIVEVLNNIQ 392 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 394 Length adjustment: 31 Effective length of query: 356 Effective length of database: 363 Effective search space: 129228 Effective search space used: 129228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory