Align Transaminase BacF; Transaminase A; EC 2.6.1.- (characterized)
to candidate WP_055435119.1 ASC41_RS02745 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::P39643 (399 letters) >NCBI__GCF_001418085.1:WP_055435119.1 Length = 379 Score = 255 bits (651), Expect = 2e-72 Identities = 144/368 (39%), Positives = 211/368 (57%), Gaps = 3/368 (0%) Query: 17 FSLVFQKVKEMEKTGAHIINLGQGNPDLPTPPHIVEALREASLNPSFHGYGPFRGYPFLK 76 FS ++V + G IINLG G+PDL P ++ A+ E+ + H Y ++G P L+ Sbjct: 15 FSKKLKEVNSLILQGKPIINLGIGSPDLQPPGKVISAITESFKDGRAHKYQSYQGIPELR 74 Query: 77 EAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDIALVPNPGYPEYLSGIT 136 EAIA FYK + V +N TEV G K G+ ++ LN GD L+PNPGYP Y S Sbjct: 75 EAIAGFYKTHFQVDVNATTEVLPLMGSKEGIMHISMAFLNEGDAVLIPNPGYPTYTSVTK 134 Query: 137 MARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPTGAVADAAFYAKAAAFA 196 + +AE L EN + P+ E+++ L K K+M+LNYP+ PTGA A A + FA Sbjct: 135 LLQAEPIFYNLDTENNWCPNIEELEKQDLSKVKIMWLNYPHMPTGAKATKAVFESLITFA 194 Query: 197 KEHNIHLIHDFAYGAFEFDQKPASFLEAEDAKTVGAELYSFSKTFNMAGWRMAFAVGNEK 256 K+H+I L++D Y +F +++P S L E AK V EL S SKTFNMAGWR+ +GN + Sbjct: 195 KKHDILLVNDNPY-SFILNKEPLSILSIEGAKDVCLELNSLSKTFNMAGWRVGMLLGNNE 253 Query: 257 IIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKERIDFFTALCEKELGWK 316 ++ AV + + ++ GMF G+QQ A AL+ SL IY++R L K L Sbjct: 254 LLNAVLKVKSNMDSGMFYGIQQGAIEALNSSKMWFVSLNNIYEKRRKLVWELATK-LNCS 312 Query: 317 MEKPKGTFYVWAEIPNTFETSHQFSDYLLEHAHVVVTPGEIFGSNGKRHVRISMVSKQED 376 ++ +VWA++P S F D LL+ ++ +TPG IFGS G+ +VR S+ + ++ Sbjct: 313 FDENATGLFVWAKLPAAL-NSEAFIDKLLKEHNLFITPGTIFGSQGEGYVRFSLCATVKE 371 Query: 377 LREFVTRI 384 L E +TR+ Sbjct: 372 LEEAITRV 379 Lambda K H 0.319 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 399 Length of database: 379 Length adjustment: 30 Effective length of query: 369 Effective length of database: 349 Effective search space: 128781 Effective search space used: 128781 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory