GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cysE in Enterococcus termitis LMG 8895

Align Serine acetyltransferase; SAT; EC 2.3.1.30 (characterized)
to candidate WP_069664896.1 BCR25_RS17495 gamma carbonic anhydrase family protein

Query= SwissProt::Q06750
         (217 letters)



>NCBI__GCF_001730305.1:WP_069664896.1
          Length = 163

 Score = 43.1 bits (100), Expect = 3e-09
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 21/122 (17%)

Query: 50  FYFLARLISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGG 109
           F  + R  + V R  TG  +  G  I     +D    V IGE      NVT+     L G
Sbjct: 27  FQAVIRGDNNVVRIGTGSNVQDGTII----HVDSDAPVSIGE------NVTIGHQCILHG 76

Query: 110 TGKEKGKRHPTIKDDALIATGAKVLGSITVGEGSKIGAGSVVLH--DVPDFSTVVGIPGR 167
                     T++D ALI  G+ +L    +G+ S IGAGS+V    ++P+     G P +
Sbjct: 77  C---------TVEDGALIGMGSTILNHAKIGKNSLIGAGSLVTEGVEIPENVLAFGRPAK 127

Query: 168 VV 169
           V+
Sbjct: 128 VI 129


Lambda     K      H
   0.323    0.141    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 104
Number of extensions: 11
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 217
Length of database: 163
Length adjustment: 20
Effective length of query: 197
Effective length of database: 143
Effective search space:    28171
Effective search space used:    28171
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory