GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisI in Enterococcus termitis LMG 8895

Align phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (characterized)
to candidate WP_069661636.1 BCR25_RS00415 phosphoribosyl-ATP diphosphatase

Query= reanno::psRCH2:GFF3874
         (110 letters)



>NCBI__GCF_001730305.1:WP_069661636.1
          Length = 103

 Score = 66.6 bits (161), Expect = 8e-17
 Identities = 42/103 (40%), Positives = 63/103 (61%), Gaps = 6/103 (5%)

Query: 5   LTRLAEVLEARKGAAPDSSYVASLYHKGLNKILEKVGEESVETILAAKDAAVSGDASDLI 64
           + +L E + ARK    D SY   L+ +G++KIL+KVGEE+ E I+AAK+     +  +L+
Sbjct: 2   IEQLYEEILARKKEPKDGSYTNYLFDQGIDKILKKVGEEATEVIIAAKN-----NEQELV 56

Query: 65  YETADLWFHSMVMLAALGQHPQAVLDELDRRFG-LSGHAEKAA 106
            ETADL +H +V+LA      +A+  EL +R G LS   E+ A
Sbjct: 57  LETADLIYHMLVLLAEKEIPLEAITQELKQREGQLSKTKERKA 99


Lambda     K      H
   0.314    0.128    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 34
Number of extensions: 2
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 110
Length of database: 103
Length adjustment: 11
Effective length of query: 99
Effective length of database: 92
Effective search space:     9108
Effective search space used:     9108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)
S2: 40 (20.0 bits)

Align candidate WP_069661636.1 BCR25_RS00415 (phosphoribosyl-ATP diphosphatase)
to HMM TIGR03188 (hisE: phosphoribosyl-ATP diphosphatase (EC 3.6.1.31))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR03188.hmm
# target sequence database:        /tmp/gapView.3189964.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03188  [M=84]
Accession:   TIGR03188
Description: histidine_hisI: phosphoribosyl-ATP diphosphatase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                             -----------
    1.3e-35  107.8   2.4    1.6e-35  107.5   2.4    1.1  1  NCBI__GCF_001730305.1:WP_069661636.1  


Domain annotation for each sequence (and alignments):
>> NCBI__GCF_001730305.1:WP_069661636.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  107.5   2.4   1.6e-35   1.6e-35       2      84 .]       3      84 ..       2      84 .. 0.97

  Alignments for each domain:
  == domain 1  score: 107.5 bits;  conditional E-value: 1.6e-35
                             TIGR03188  2 eeLeevieerkeedpeeSytakllekgedkilkKvgEEavEviiaaknedkeelveEaaDllYhllVllaekgvs 76
                                          e+L+e i +rk+e++++Syt++l+++g+dkilkKvgEEa+Eviiaakn+ ++elv E+aDl+Yh+lVllaek++ 
  NCBI__GCF_001730305.1:WP_069661636.1  3 EQLYEEILARKKEPKDGSYTNYLFDQGIDKILKKVGEEATEVIIAAKNN-EQELVLETADLIYHMLVLLAEKEIP 76
                                          79*********************************************96.669********************** PP

                             TIGR03188 77 ledvlaeL 84
                                          le++++eL
  NCBI__GCF_001730305.1:WP_069661636.1 77 LEAITQEL 84
                                          ******98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (84 nodes)
Target sequences:                          1  (103 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 5.87
//
[ok]

This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory