Align phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (characterized)
to candidate WP_069661636.1 BCR25_RS00415 phosphoribosyl-ATP diphosphatase
Query= reanno::psRCH2:GFF3874 (110 letters) >NCBI__GCF_001730305.1:WP_069661636.1 Length = 103 Score = 66.6 bits (161), Expect = 8e-17 Identities = 42/103 (40%), Positives = 63/103 (61%), Gaps = 6/103 (5%) Query: 5 LTRLAEVLEARKGAAPDSSYVASLYHKGLNKILEKVGEESVETILAAKDAAVSGDASDLI 64 + +L E + ARK D SY L+ +G++KIL+KVGEE+ E I+AAK+ + +L+ Sbjct: 2 IEQLYEEILARKKEPKDGSYTNYLFDQGIDKILKKVGEEATEVIIAAKN-----NEQELV 56 Query: 65 YETADLWFHSMVMLAALGQHPQAVLDELDRRFG-LSGHAEKAA 106 ETADL +H +V+LA +A+ EL +R G LS E+ A Sbjct: 57 LETADLIYHMLVLLAEKEIPLEAITQELKQREGQLSKTKERKA 99 Lambda K H 0.314 0.128 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 34 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 110 Length of database: 103 Length adjustment: 11 Effective length of query: 99 Effective length of database: 92 Effective search space: 9108 Effective search space used: 9108 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 40 (20.0 bits)
Align candidate WP_069661636.1 BCR25_RS00415 (phosphoribosyl-ATP diphosphatase)
to HMM TIGR03188 (hisE: phosphoribosyl-ATP diphosphatase (EC 3.6.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03188.hmm # target sequence database: /tmp/gapView.3189964.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03188 [M=84] Accession: TIGR03188 Description: histidine_hisI: phosphoribosyl-ATP diphosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-35 107.8 2.4 1.6e-35 107.5 2.4 1.1 1 NCBI__GCF_001730305.1:WP_069661636.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001730305.1:WP_069661636.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.5 2.4 1.6e-35 1.6e-35 2 84 .] 3 84 .. 2 84 .. 0.97 Alignments for each domain: == domain 1 score: 107.5 bits; conditional E-value: 1.6e-35 TIGR03188 2 eeLeevieerkeedpeeSytakllekgedkilkKvgEEavEviiaaknedkeelveEaaDllYhllVllaekgvs 76 e+L+e i +rk+e++++Syt++l+++g+dkilkKvgEEa+Eviiaakn+ ++elv E+aDl+Yh+lVllaek++ NCBI__GCF_001730305.1:WP_069661636.1 3 EQLYEEILARKKEPKDGSYTNYLFDQGIDKILKKVGEEATEVIIAAKNN-EQELVLETADLIYHMLVLLAEKEIP 76 79*********************************************96.669********************** PP TIGR03188 77 ledvlaeL 84 le++++eL NCBI__GCF_001730305.1:WP_069661636.1 77 LEAITQEL 84 ******98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (84 nodes) Target sequences: 1 (103 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.87 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory