Align Aromatic-amino-acid aminotransferase 1; ARAT-I; AROAT; EC 2.6.1.57 (characterized)
to candidate WP_069664972.1 BCR25_RS17850 PLP-dependent aminotransferase family protein
Query= SwissProt::H3ZPL1 (417 letters) >NCBI__GCF_001730305.1:WP_069664972.1 Length = 480 Score = 171 bits (434), Expect = 3e-47 Identities = 121/407 (29%), Positives = 209/407 (51%), Gaps = 28/407 (6%) Query: 14 PTLDYEKYFSEKALGMKASEIRELLKLVETS--DVISLAGGLPAPETFPVEIIGEIT-KE 70 P D+ Y + A + ++ +L+ +S D++ + G + P +T K Sbjct: 86 PRTDWRHYLEQNAFAKVDPYLEQIEQLIHSSADDLLDVYTGELPLDLIPSFAFPPLTWKH 145 Query: 71 VLEKHAAQALQYGTTKGFTPLRLALAEWMRERYDIPISKVDIMTTSGSQQALDLIGRVFI 130 LE+ L G+ PLR +L++ M++ YD + + TSG+QQAL LI +V + Sbjct: 146 FLEEEQQDDL------GYLPLRESLSQDMQKEYDFTLPPESFLITSGAQQALFLILQVLL 199 Query: 131 NPGDIIVVEAPTYLAALQAFKYYEPEFVQIPLDDEGMNVDLLEEKLQELEKEGKKVKIVY 190 PGD + +E P++L AL F+ + +D EG+ +D LE+ +++ ++K+V Sbjct: 200 QPGDSVAIEDPSFLYALPIFQAAGIRLYGVKMDQEGICIDSLEKTIRQ-----HRIKMVM 254 Query: 191 TIPTFQNPAGVTMNEKRRKRLLELASQYDFIIVEDNPYGELRY-SGEPVKPIKAWDEEGR 249 P+FQNP G TM+ KRRK+L+EL Y I+ED+ + +L + S E V+P+K D E Sbjct: 255 VNPSFQNPTGKTMSMKRRKQLIELCQNYQIPILEDDVFAKLNFVSTEQVQPLKKLDPE-N 313 Query: 250 VIYLGTFSKILAPGFRIGWIAAEPHFIRKLEIAKQSVDLCTNTFSQVIAWKYVEGGYLDK 309 V+Y+G+ SKIL +IGW++A ++L A++ +D + F QV+A D Sbjct: 314 VLYIGSLSKILGSTTKIGWLSAPASVNQQLAEARKMMDFSLSIFPQVLA----NLALTDN 369 Query: 310 HIPKIIEFYKPRRDAMLKALEEFMPDGVKW--TKPEGGMFVWATLPEGIDTKLMLEKAVA 367 + K I + +A +A+ + M +W +P+GG ++WA G + + Sbjct: 370 NFSKKITELRQEVEARGQAVFDLMSKMEEWEVARPKGGYYLWAKWKNGDLRQKDWALFLQ 429 Query: 368 KGVAYVPGEAFFAHRDVKNTMRLNFTYVPEEKI---REGIKRLAETI 411 +G+ P F RD ++R+NF+ V I +E ++R+ E I Sbjct: 430 EGLLLAPSFFFSESRD---SIRINFSRVSSHNIVEFKEKLERITEKI 473 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 472 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 480 Length adjustment: 33 Effective length of query: 384 Effective length of database: 447 Effective search space: 171648 Effective search space used: 171648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory