Align aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_069665237.1 BCR25_RS19265 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q9RAT0 (391 letters) >NCBI__GCF_001730305.1:WP_069665237.1 Length = 387 Score = 492 bits (1266), Expect = e-144 Identities = 241/386 (62%), Positives = 312/386 (80%), Gaps = 1/386 (0%) Query: 1 MDLLKKFNPNLDKIEISLIRQFDQQVSSIPDIIKLTLGEPDFYTPEHVKQAGIAAIENNQ 60 MDL ++FN + KI +S IRQFD+QVSSI I+KLTLGEPDF TPEHVK A AI++N Sbjct: 1 MDLTQRFNKQVYKIAVSTIRQFDEQVSSIEGILKLTLGEPDFNTPEHVKTAAHQAIDDNF 60 Query: 61 SHYTGMAGLLELRQAASEFLLKKYGLSYAAEDEILVTVGVTEAISSVLLSILVAGDEVLI 120 SHY+GMAGL ++R+AA+ F+ +KYG+ Y A E+LVTVG TEAIS+ LL+IL GD++L+ Sbjct: 61 SHYSGMAGLTDVREAAALFMQEKYGVRYDAASEVLVTVGATEAISASLLAILEPGDKLLM 120 Query: 121 PAPAYPGYEPLITLAGGSLVEIDTRANDFVLTPEMLDQAIIEREGKVKAVILNYPANPTG 180 PAP YPGYEP+ITLA V IDTR+N+FVLTP+M++ A+ E +VKA+ILNYP+NPTG Sbjct: 121 PAPIYPGYEPVITLANAEPVYIDTRSNNFVLTPQMIEDAMAEHGDQVKAIILNYPSNPTG 180 Query: 181 VTYNREQIKDLAEVLKKHEVFVIADEVYSELNYTDQPHVSIAEYAPEQTIVLNGLSKSHA 240 VTYNRE++K +A+V+KK+ +FVI+DE+YSEL Y D+ HVSIAE+ PEQTI++NGLSKSHA Sbjct: 181 VTYNREEVKAIADVVKKYPIFVISDEIYSELTYEDE-HVSIAEFIPEQTILINGLSKSHA 239 Query: 241 MTGWRIGLIFAARELVAQIIKTHQYLVTSASTQSQFAAIEALKNGADDALPMKKEYLKRR 300 MTGWRIG IF L+A+IIK HQYLVT+AST SQ AA+ AL G DA MK+EY +RR Sbjct: 240 MTGWRIGFIFGPNVLIAEIIKVHQYLVTAASTISQKAAVRALIEGIHDAAVMKEEYRERR 299 Query: 301 DYIIEKMSALGFKIIEPDGAFYIFAKIPADLEQDSFKFAVDFAKENAVAIIPGIAFGQYG 360 D++ E+M+ +GF++ P+GAFYIFAKIP EQDS KF VD A++ A+AIIPGIAFGQ G Sbjct: 300 DFVYEQMTNIGFEVARPNGAFYIFAKIPEGYEQDSMKFCVDLAQKQAIAIIPGIAFGQEG 359 Query: 361 EGFVRLSYAASMDVIEQAMARLTDYV 386 EG+VR+SYAA +D +++AM R+ +Y+ Sbjct: 360 EGYVRISYAADLDTLKEAMRRIANYM 385 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 478 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 387 Length adjustment: 30 Effective length of query: 361 Effective length of database: 357 Effective search space: 128877 Effective search space used: 128877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory