Align Carbamoyl-phosphate synthase small chain; EC 6.3.5.5; Carbamoyl-phosphate synthetase glutamine chain (uncharacterized)
to candidate WP_085637398.1 MGEO_RS11340 aminodeoxychorismate/anthranilate synthase component II
Query= curated2:Q8KGA2 (366 letters) >NCBI__GCF_002115805.1:WP_085637398.1 Length = 193 Score = 92.0 bits (227), Expect = 1e-23 Identities = 64/177 (36%), Positives = 88/177 (49%), Gaps = 13/177 (7%) Query: 189 NIIRQLNAEGCKVTVV-NAKTTADEVLAMNPDGIFLSNGPGDPFAVTYAIDTIRELAARN 247 N++ L G V VV N T + + +NP GI LS GP DP + LAA Sbjct: 14 NLVHYLGELGTDVKVVRNDALTVQDAMGLNPSGILLSPGPCDPDQAGICLPLT--LAAAE 71 Query: 248 STLPIFGICLGHQLLSLAFGAKTYKLKFGHHGA----NHPVKNL---LSNTIEITSQNHG 300 + +P+ G+CLGHQ L AFG + HG +H K + L + E T + H Sbjct: 72 TGMPLMGVCLGHQTLGQAFGGSVVRHSEIVHGKMGLMHHAGKGVFAGLPSPFEAT-RYHS 130 Query: 301 FAVEMESLPGELELTHKNLYDMTVEGIRHRELPCFSVQYHPEAAPGPHDSHYLFKEF 357 V+ +++P LE+T L D TV G+ HR+LP VQ+HPE+ H H L K F Sbjct: 131 LVVDKDTIPNCLEVTAW-LEDGTVMGLSHRDLPMHGVQFHPESIASEH-GHALLKNF 185 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 193 Length adjustment: 25 Effective length of query: 341 Effective length of database: 168 Effective search space: 57288 Effective search space used: 57288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory