Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_085635818.1 MGEO_RS06080 triose-phosphate isomerase
Query= SwissProt::Q8L1Z5 (254 letters) >NCBI__GCF_002115805.1:WP_085635818.1 Length = 245 Score = 253 bits (645), Expect = 3e-72 Identities = 136/246 (55%), Positives = 171/246 (69%), Gaps = 13/246 (5%) Query: 6 RPFIAGNWKMNGTGESLGELRA---IAAGISSDLGRLFEALICVPATLLSRAFDILGGEN 62 R AGNWKMNGT +L EL A +A G + E LIC P+TL+++A G Sbjct: 3 RKLAAGNWKMNGTTAALEELDALQEVAEGAA-------EVLICPPSTLIAQAAVRSG--K 53 Query: 63 ILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWR 122 + +GGQ+CH G +TGDISA ML++AGA+HVI+GHSERR + ESDA+V K AAW Sbjct: 54 VAIGGQDCHSAASGAHTGDISALMLRDAGATHVILGHSERRADHGESDALVAYKALAAWD 113 Query: 123 AGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWAVGTGNTATS 182 AGL A++CVGETLE+R+S K LDV+ +QL GSLPD TA N +IAYEPVWA+GTG T+ Sbjct: 114 AGLTAIVCVGETLEQRESGKTLDVIGKQLAGSLPDDVTASNTVIAYEPVWAIGTGKVPTT 173 Query: 183 ADVAEVHAFIHHKMHSRFGDEGAK-IRLLYGGSVKPSNAFELLSTAHVNGALIGGASLKA 241 +AEVH F+ + RFG+E A IRLLYGGSVK +NA E+ + V+GAL+GGASLKA Sbjct: 174 DQIAEVHTFMRATLVQRFGNETATGIRLLYGGSVKATNATEIFAVVDVDGALVGGASLKA 233 Query: 242 IDFLTI 247 DF I Sbjct: 234 SDFAPI 239 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 245 Length adjustment: 24 Effective length of query: 230 Effective length of database: 221 Effective search space: 50830 Effective search space used: 50830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate WP_085635818.1 MGEO_RS06080 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00419.hmm # target sequence database: /tmp/gapView.2802952.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-58 184.5 3.0 1.5e-58 184.3 3.0 1.0 1 NCBI__GCF_002115805.1:WP_085635818.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_002115805.1:WP_085635818.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 184.3 3.0 1.5e-58 1.5e-58 3 227 .. 7 233 .. 5 234 .. 0.90 Alignments for each domain: == domain 1 score: 184.3 bits; conditional E-value: 1.5e-58 TIGR00419 3 iinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeveseiqvaAqnvdavksGaftGeisA 75 +n+K+n+++ e+ + l +eva+ a ev + pp + ++ + ++ ++ q+++ sGa+tG+isA NCBI__GCF_002115805.1:WP_085635818.1 7 AGNWKMNGTTAALEE-LDAL-QEVAEGAA-EVLICPPSTLIAQAAVRSG-KVAIGGQDCHSAASGAHTGDISA 75 69*******998765.5555.57998765.6667777666655443333.6********************** PP TIGR00419 76 emlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvattaaaaA.. 146 ml+d+Ga +v++gHsErR+ + e+d l++ k + + gl+++vCvgetle+re+++t++++ ++ a NCBI__GCF_002115805.1:WP_085635818.1 76 LMLRDAGATHVILGHSERRADHGESDALVAYKALAAWDAGLTAIVCVGETLEQRESGKTLDVIGKQLAGSLpd 148 ****************************************************************998876567 PP TIGR00419 147 ...lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkk.vskevaesvrvlyGasvtaaedaelaaqldv 215 ++ v+A+EPv++iGtGk+ + + +v+ ++r l + +e a +r+lyG+sv+a++++e +a dv NCBI__GCF_002115805.1:WP_085635818.1 149 dvtASNTVIAYEPVWAIGTGKVPTTDQIAEVHTFMRATLVQrFGNETATGIRLLYGGSVKATNATEIFAVVDV 221 76699*******************************98877699***************************** PP TIGR00419 216 dGvLlasavlka 227 dG+L+++a+lka NCBI__GCF_002115805.1:WP_085635818.1 222 DGALVGGASLKA 233 ***********9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (245 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.22 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory