Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate WP_085635195.1 MGEO_RS03030 acyltransferase
Query= BRENDA::A0A0H2UNY1 (205 letters) >NCBI__GCF_002115805.1:WP_085635195.1 Length = 199 Score = 53.9 bits (128), Expect = 2e-12 Identities = 41/116 (35%), Positives = 56/116 (48%), Gaps = 6/116 (5%) Query: 64 QIEIHPGAQIDSGVFIDHGSGLVIGETAIVEKGVLLY---HGVTLGG-TGKDCGKRHPT- 118 ++ I P ++ V ID L IG ++ V L H LG G K PT Sbjct: 75 RLRIGPRVYVNRNVMIDVSDELTIGADTMIGPFVYLTDHDHEAKLGQRVGDQPLKAAPTH 134 Query: 119 VRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIPAKIVR-LHGKK 173 V + I A+A V+ V IG+NA VGA AVV D+P+ G+PA+ LHG + Sbjct: 135 VGRNVWIGANAIVLKGVTIGDNAIVGAGAVVTKDIPAGAVATGVPARFSEWLHGSR 190 Lambda K H 0.319 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 92 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 199 Length adjustment: 21 Effective length of query: 184 Effective length of database: 178 Effective search space: 32752 Effective search space used: 32752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory