Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate WP_085635038.1 MGEO_RS02170 phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_002115805.1:WP_085635038.1 Length = 531 Score = 206 bits (523), Expect = 3e-57 Identities = 119/320 (37%), Positives = 176/320 (55%), Gaps = 8/320 (2%) Query: 235 VLLLENVHPIGVEIMKQEGYNVEVVSS-AMSEEELCEKIKNVSIIGIRSKTQITKKVLEN 293 VL+ + + V+I K G V+ + +++L E I + IRS T++T +LEN Sbjct: 5 VLISDKLSDAAVQIFKDRGIEVDFQPNLGKDKDKLAEVIGQYDGLAIRSATKVTPTILEN 64 Query: 294 ANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRNLHDKTL 353 A L +G IGT+ ID + +KG+ V N PF N + E AI+ + R + + + Sbjct: 65 ATNLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFACARQIPEASA 124 Query: 354 KMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYD--IVERLALGN 411 H G W KS E+ GK LG+IG GNIG + A + M V YD + E A Sbjct: 125 STHAGKWEKSKFMGVELTGKTLGVIGAGNIGGIVCDRARGLKMKVIAYDPFLGEDKAKQM 184 Query: 412 ATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVVDVPALR 471 + LD+LL+ D I+LHV + +NIL++E + K KKG ++N +RG +VD AL Sbjct: 185 QVEKVELDDLLKRADFITLHVPLTDQTRNILSRENLEKTKKGVRIINCARGGLVDEEALA 244 Query: 472 DALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENIAQFVPG 531 D L+SGH+AGAA DVF EP E+ L PN + TPH+G +T EAQEN+A V Sbjct: 245 DLLKSGHVAGAAFDVFSEEPAT-----ENPLFNLPNVVCTPHLGAATTEAQENVALQVAE 299 Query: 532 KIIEYINSGNTFNSVNFPNI 551 ++ Y+ +G N++N P++ Sbjct: 300 QMANYLLTGAVENALNMPSV 319 Score = 25.0 bits (53), Expect = 0.009 Identities = 14/62 (22%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Query: 559 AHRLIHIHQNAPGVLAKINQVLASYKINIVGQYLKTNEKIGYVIT--DIDKRYSNDVIDA 616 AH + +++ PG++ + + +NI L + G I +D+ +V+D Sbjct: 454 AHMVYTTNEDVPGIIGTLGTTMGENNVNIANFTLGRSAAKGEAIALLYVDEPVPANVVDK 513 Query: 617 LK 618 LK Sbjct: 514 LK 515 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 677 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 630 Length of database: 531 Length adjustment: 36 Effective length of query: 594 Effective length of database: 495 Effective search space: 294030 Effective search space used: 294030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory