Align Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 (characterized, see rationale)
to candidate WP_085641330.1 MGEO_RS19085 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein
Query= uniprot:Q72EV2_DESVH (209 letters) >NCBI__GCF_002115805.1:WP_085641330.1 Length = 237 Score = 46.6 bits (109), Expect = 4e-10 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 20/117 (17%) Query: 70 LPRTVPVLGVCLGHQVLGLYAGATVEVGPRIMHGK--------------TSDITHDGAGL 115 L R +PVLG+C G Q+L + G T++ +G+ D TH L Sbjct: 89 LERNIPVLGICRGSQMLNVALGGTLDQDAWGTYGRERMIKTVLPKREIHVEDRTH--LSL 146 Query: 116 FAGLPQPMTVGRYHSLIVRAEEKPDLLEVTARTPEGEVMAM-RYRDRPWVGVQFHPE 171 +G PM V H+ V + D L V+AR G V A+ R RD +GVQ+HPE Sbjct: 147 ISG-NDPMKVNALHTQAV--DRLGDGLRVSARDTGGMVQAVERVRDPFALGVQWHPE 200 Lambda K H 0.323 0.141 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 209 Length of database: 237 Length adjustment: 22 Effective length of query: 187 Effective length of database: 215 Effective search space: 40205 Effective search space used: 40205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory