Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_085641408.1 MGEO_RS19475 3-deoxy-8-phosphooctulonate synthase
Query= BRENDA::P39912 (358 letters) >NCBI__GCF_002115805.1:WP_085641408.1 Length = 272 Score = 96.7 bits (239), Expect = 6e-25 Identities = 80/255 (31%), Positives = 124/255 (48%), Gaps = 25/255 (9%) Query: 122 IVGPCAVESYEQV----AEVAAAAKKQGIKILRGGAFKP--RTSPYDFQGLGV-EGLQIL 174 I GPC +ES + +AAAA+ + ++ R+S +GLG+ EGL IL Sbjct: 20 IAGPCQLESLDHARMLATRIAAAAEATDTPWIFKASYDKANRSSLKGKRGLGMDEGLTIL 79 Query: 175 KRVADEFDLAVISEIVTPAHIEEALDYIDVIQIGARNMQNFELLKAAGAVKKPVLLKRGL 234 R+ EF + V+++I T +DV+QI A + +LL AAG + +K+G Sbjct: 80 DRIKAEFGVPVLTDIHTAEQCAPVAQVVDVLQIPAFLSRQTDLLLAAGETGAAINVKKGQ 139 Query: 235 AATISEFINAAEYIMSQGNDQIILCERGIRTYETATRNTL--DISAVPILKQETHLPVFV 292 + N A I S GN++I+LCERG + N L D+ ++PI+ Q T PV Sbjct: 140 FLAPWDMENVAAKIASTGNERILLCERG----ASFGYNMLVSDMRSLPIMAQ-TGYPVVF 194 Query: 293 DVTHST-----------GRRDLLLPTAKAALAIGADGVMAEVHPDPSVALSDSAQQMAIP 341 D THS G+R+ + A+AA+A+G V E H P A SD + I Sbjct: 195 DATHSVQLPGGQGTSSGGQREFVPHLARAAVAVGCAAVFIETHDAPDNAPSDGPNMVPID 254 Query: 342 EFEKWLNELKPMVKV 356 + + L ++ + +V Sbjct: 255 QLKGLLLVMRRIDRV 269 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 272 Length adjustment: 27 Effective length of query: 331 Effective length of database: 245 Effective search space: 81095 Effective search space used: 81095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory