Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate WP_157843930.1 CV091_RS00350 cystathionine beta-lyase
Query= reanno::Korea:Ga0059261_3194 (402 letters) >NCBI__GCF_002796795.1:WP_157843930.1 Length = 391 Score = 150 bits (378), Expect = 8e-41 Identities = 115/367 (31%), Positives = 176/367 (47%), Gaps = 21/367 (5%) Query: 40 LTSGYAYDCAGD-AAARFSGDQQG-MTYSRLQNPTVEMLEQRIALLEGAEACRATASGMA 97 L S +D G AAR + + G + Y R N LEQ IA LEGA+A T+SG+A Sbjct: 32 LGSTMVFDTLGAFEAARDARYESGTLYYGRYGNSATTKLEQAIARLEGADAVTLTSSGVA 91 Query: 98 AMTAALLCQLSAGDHLIGGRAAFGSCRWLTDTQLPKFGIETTVVDARDPQQFIDAIRPNT 157 A+T +L+ G H++ +G+ R D L + G+E + D D IRPNT Sbjct: 92 AITTSLMTFTKPGAHVLVADHVYGNTRTFCDGLLTRQGVEISYFDPLIGSGITDLIRPNT 151 Query: 158 KVFFFETPANPTMDVVDLKAVCAIARERGIVTVVDNAFATPALQRPMDFGADVVAYSATK 217 FE P + T +V D+ A+ A+ G+VT++DN ++TP +P+ G DVV YS +K Sbjct: 152 VAIMFEAPGSGTFEVPDIPAIAMAAKAAGVVTILDNTWSTPLFCQPLSLGVDVVVYSGSK 211 Query: 218 MMDGQGRVLAGAVCGTEEF---INNTLLPFHRNTGPTLSPFNAWVVLKGLETLDLRIQRQ 274 + G + G T + I T++ TG + L+GL TL +R++ Sbjct: 212 YLSGHSDCMLGVTATTLKHHMAIRQTIMQIGDKTGGQ----EIMLALRGLRTLKVRMEYF 267 Query: 275 SENALKVAR-FLE-GRVPRVNFPGLPSHPQHNLAMSQMAAAGPIFSIELDGGRT-QAHGL 331 ++A+ FLE V + P + P H + A +FS+ L T + Sbjct: 268 DRVGREMAQWFLERPEVKTILHPAFETCPGHANWKRDFSGAASLFSVILKPCDTIRMRAF 327 Query: 332 LDALGLIDISNNIGDSRSLMTHPASTTHSGVAEDQRLLMGVGEG-MLRLNVGLEDPEDLI 390 ++AL I + G SL+ P + A ++ EG ++R N+G+EDPE L Sbjct: 328 VNALHHFGIGVSWGGYESLVL-PVEPVRTATAWEE-------EGHLIRFNIGMEDPESLK 379 Query: 391 ADLDQAL 397 ADL QA+ Sbjct: 380 ADLAQAM 386 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 391 Length adjustment: 31 Effective length of query: 371 Effective length of database: 360 Effective search space: 133560 Effective search space used: 133560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory