Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_101442815.1 BD749_RS02630 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Query= curated2:P36839 (385 letters) >NCBI__GCF_002846395.1:WP_101442815.1 Length = 383 Score = 278 bits (710), Expect = 2e-79 Identities = 166/369 (44%), Positives = 231/369 (62%), Gaps = 12/369 (3%) Query: 3 SLFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDSVW 62 +LF Y +DI+ +A G V D+ G+ YLD G AV ++GH H + + +QL + Sbjct: 2 NLFDVYPLFDIEPVRAAGLSVWDKEGRKYLDLYGGHAVISIGHSHPHYVKRIARQLYDIG 61 Query: 63 HVSNLFQNSLQEQAAQKLAAHSAGDLV--FFCNSGAEANEGAIKLARKATGKTKIITFLQ 120 SN Q +Q++ A KL S D F CNSGAEANE A+KLA TG+ K+I+F Sbjct: 62 FYSNAVQMPMQQELAVKLGKLSGYDAYSFFLCNSGAEANENALKLASFQTGRKKVISFSA 121 Query: 121 SFHGRTYAGMAATGQDKIKTGFGPMLGGFHYLPYNDPSAFK-ALGEEG-DIAAVMLETVQ 178 SFHGRT A +AAT I ++P+ND +AF+ AL + G ++AAV++E +Q Sbjct: 122 SFHGRTSAAVAATDDTSIVAPIN-QTDNIIFMPFNDVAAFEEALQKHGQELAAVIVEGIQ 180 Query: 179 GEGGVNPASAEFLSAVQSFCKEKQALLIIDEIQTGIGRTGKGFAYEHFGLSPDIITVAKG 238 G GGVN + FL A+++ CK+ ALLI+DE+Q+G GR+GK FA++H G+ PD+ITVAKG Sbjct: 181 GVGGVNIPTVNFLKALEAGCKKVGALLILDEVQSGYGRSGKFFAHQHAGIQPDLITVAKG 240 Query: 239 LGNGFPVGAVIGKKQLGEAFTPGSHGTTFGGNMLAMAAVNATLQIVFQPDFLQEAADKGA 298 +GNGFPVG V+ ++ EA G GTTFGGN LA AA A L+++ + + L+ A G Sbjct: 241 MGNGFPVGGVLISPEI-EA-RHGMLGTTFGGNYLACAASLAVLEVIEKEELLENATIMGH 298 Query: 299 FLKEQLEAELKSPFVKQIRGKGLMLGIECDGPVADIIAE-LQTLGLLV-LPAGPNVIRLL 356 +LKEQLE P VK++RG+GLM+GIE + P A I E L G+ + N +RLL Sbjct: 299 YLKEQLEG---MPGVKEVRGQGLMIGIELNEPCAGIRKELLSQFGIFTGSSSNKNTLRLL 355 Query: 357 PPLTVTKDE 365 P LT++K E Sbjct: 356 PALTISKAE 364 Lambda K H 0.318 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 383 Length adjustment: 30 Effective length of query: 355 Effective length of database: 353 Effective search space: 125315 Effective search space used: 125315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory