Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate WP_101444119.1 BD749_RS09430 shikimate dehydrogenase
Query= reanno::Btheta:353741 (248 letters) >NCBI__GCF_002846395.1:WP_101444119.1 Length = 245 Score = 232 bits (592), Expect = 5e-66 Identities = 125/248 (50%), Positives = 163/248 (65%), Gaps = 8/248 (3%) Query: 1 MEKYGLIGYPLRHSFSIGYFNEKFRSEGI-NAEYVNFEIPNINDFMEVIEENPNLCGLNV 59 M ++GLIG L HSFS YF+EKF EGI +A Y +E+P I +F +++ P L GLNV Sbjct: 1 MRRFGLIGKKLGHSFSKRYFSEKFAQEGIADAAYELYELPEIAEFPKLLAREPELVGLNV 60 Query: 60 TIPYKEQVIPFLNELDRDTAKIGAVNVIKIIRQPKGKVKLVGYNSDIIGFTQSIQPLLQP 119 T+PYKE VIP+L+ELD A+IGAVN I+I + + GYN+D IGF ++ P Sbjct: 61 TVPYKELVIPYLHELDESAARIGAVNTIRIEGE-----RTKGYNTDYIGFRDTLLQFCPP 115 Query: 120 QHK-KALILGTGGASKAVYHGLKNLGIESVFVSRTHKTDDMLTYEELTPEIMEEYTVIVN 178 + KAL+LGTGGA+KAV+ L L I VSR + T + L YE +T E+++ Y++I+N Sbjct: 116 EEGVKALVLGTGGAAKAVWATLDELAIPYTSVSR-NPTQNQLHYEAITTEVLQAYSLIIN 174 Query: 179 CTPVGMYPKVDFCPNIPYELLTPNHLLYDLLYNPNVTLFMKKGEAQGAVTKNGLEMLLLQ 238 TP+GM P P IPYE LT H LYDL+YNP TLF++KG GA T NGL ML Q Sbjct: 175 TTPLGMAPNTAAAPAIPYEALTAGHYLYDLVYNPEETLFLQKGRLAGAHTINGLPMLYAQ 234 Query: 239 AFAAWEIW 246 A AAW+IW Sbjct: 235 ADAAWKIW 242 Lambda K H 0.320 0.140 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 245 Length adjustment: 24 Effective length of query: 224 Effective length of database: 221 Effective search space: 49504 Effective search space used: 49504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory