Align ornithine aminotransferase (characterized)
to candidate WP_101442815.1 BD749_RS02630 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Query= CharProtDB::CH_124176 (442 letters) >NCBI__GCF_002846395.1:WP_101442815.1 Length = 383 Score = 201 bits (510), Expect = 4e-56 Identities = 134/400 (33%), Positives = 206/400 (51%), Gaps = 40/400 (10%) Query: 46 RAQGVNVWDPEGKHYLDLLSAYSAVNQGHCHPELIKALAEQAGRLTLSSRAFYNDVFPVW 105 RA G++VWD EG+ YLDL ++ ++ GH HP +K +A Q + S A + Sbjct: 16 RAAGLSVWDKEGRKYLDLYGGHAVISIGHSHPHYVKRIARQLYDIGFYSNAVQMPMQQEL 75 Query: 106 AAKVRDLFGYDMV--LPMNTGAEAVETAIKIARKWAYKVKGVPQGKAHVFSVADNFHGRT 163 A K+ L GYD N+GAEA E A+K+A G+ V S + +FHGRT Sbjct: 76 AVKLGKLSGYDAYSFFLCNSGAEANENALKLA--------SFQTGRKKVISFSASFHGRT 127 Query: 164 MTAISLSTD-----PESRDNYGPYVPNIGAICPTTGRQIRYNNISDLEIVLEAHGAETAA 218 A++ + D P ++ + ++P +N+++ E L+ HG E AA Sbjct: 128 SAAVAATDDTSIVAPINQTDNIIFMP--------------FNDVAAFEEALQKHGQELAA 173 Query: 219 FIVEPIQGEAGVVVPDDDYLAKVHALCKKHNVLFICDEIQTGIARTGKMLCCNWAGIKPD 278 IVE IQG GV +P ++L + A CKK L I DE+Q+G R+GK AGI+PD Sbjct: 174 VIVEGIQGVGGVNIPTVNFLKALEAGCKKVGALLILDEVQSGYGRSGKFFAHQHAGIQPD 233 Query: 279 IVTLGKAISGGMYPVSCVLADKDVMMVVEPGTHGSTYGGNPLGCAVSIRALELVEEGKLA 338 ++T+ K + G +PV VL ++ G G+T+GGN L CA S+ LE++E+ +L Sbjct: 234 LITVAKGMGNG-FPVGGVLISPEI--EARHGMLGTTFGGNYLACAASLAVLEVIEKEELL 290 Query: 339 DQADHLGRIFREGVEAFKSPIVQQVRGKGLLNAVVIDESAAGGRTAWDLCMLLKSKGLL- 397 + A +G +E +E P V++VRG+GL+ + ++E AG R LL G+ Sbjct: 291 ENATIMGHYLKEQLEGM--PGVKEVRGQGLMIGIELNEPCAGIRKE-----LLSQFGIFT 343 Query: 398 AKPTHGNIIRFAPPLIITEEELKKALSIIGEALTELPTAE 437 ++ N +R P L I++ E L LT+ TA+ Sbjct: 344 GSSSNKNTLRLLPALTISKAEADLFLKAFSSILTKKVTAK 383 Lambda K H 0.318 0.135 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 383 Length adjustment: 31 Effective length of query: 411 Effective length of database: 352 Effective search space: 144672 Effective search space used: 144672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory