Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_106719010.1 CU100_RS23130 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_003010935.1:WP_106719010.1 Length = 413 Score = 275 bits (702), Expect = 2e-78 Identities = 168/410 (40%), Positives = 235/410 (57%), Gaps = 12/410 (2%) Query: 5 LTEKTAEQLPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAPVHIA 64 L K +P I G+ + TA+AG+K G TD+ LI + V VFT ++ +A V Sbjct: 8 LAPKHYPSMPGIQGVRIATAEAGIKYKGRTDVLLIVFDRPTAVAGVFTRSKCPSAAVDFC 67 Query: 65 KSHLFDEDGV-RALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTGVIL 123 ++ L E G RA+V+N+GNANA TG +GR A AAAA+ +G KP+ + STGVI Sbjct: 68 RASL--EGGTARAVVVNSGNANAFTGKKGRESAKMTAAAAAKAVGAKPHSIFLASTGVIG 125 Query: 124 EPLPADKIIAALPKMQPAF----WNEAARAIMTTDTVPKAASREGKVGDQHTVRATGIAK 179 EPL A K L M W +AA AIMTTDT PK ++ +G V GIAK Sbjct: 126 EPLDAGKFSHLLADMVNNAVADRWPDAASAIMTTDTFPKLSTETVLLGGV-PVTINGIAK 184 Query: 180 GSGMIHPNMATMLGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATG 239 G+GMI P+MATML F+ATDA ++ VLQ + + ++FN++TVD DTST+D+ ++ ATG Sbjct: 185 GAGMIAPDMATMLSFVATDAPIAADVLQRLLSKSVGKSFNSVTVDSDTSTSDTLLLFATG 244 Query: 240 KNSQ---SEIDNIADPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEA 296 ++ + + D R + L + +LA +VRDGEGA K + + V A + A Sbjct: 245 SAAERGAEPVTKLKDKRLKPFAKALDRVLKDLALQVVRDGEGARKMLEISVTGATSSRSA 304 Query: 297 RQAAYAAARSPLVKTAFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRA 356 ++ A + A SPLVKTA D N G+ + A+G A D D + + +I VA G R Sbjct: 305 KRIALSIANSPLVKTAAAGEDANWGRIVMAVGKAG-EPADRDRLAISFGEIRVAREGERD 363 Query: 357 ASYTEAQGQAVMSKDEITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 Y+EA A M DEI + + + G+ ATV+TCDL+ YV+IN DYRS Sbjct: 364 PDYSEAATSAYMKNDEIKISVDIGLGKGKATVWTCDLTKEYVAINGDYRS 413 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 12 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 413 Length adjustment: 31 Effective length of query: 375 Effective length of database: 382 Effective search space: 143250 Effective search space used: 143250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory