Align cystathionine β-synthase (O-acetyl-L-serine) monomer (EC 4.2.1.22; EC 2.5.1.134; EC 2.5.1.47) (characterized)
to candidate WP_106716171.1 CU100_RS08500 cysteine synthase A
Query= metacyc::HP_RS00545-MONOMER (306 letters) >NCBI__GCF_003010935.1:WP_106716171.1 Length = 324 Score = 221 bits (564), Expect = 1e-62 Identities = 127/307 (41%), Positives = 185/307 (60%), Gaps = 5/307 (1%) Query: 3 IITTMQDAIGRTPVFKFTNKDYPIPLNSAIYAKLEHLNPGGSVKDRLGQYLIGEGFKTGK 62 I ++ D IG TP+ + + + + AKLE NP SVKDR+G LI G+ Sbjct: 14 IYNSIVDTIGDTPLIRLDKLAKEKGVGANLLAKLEFFNPISSVKDRIGVALIEALEVQGR 73 Query: 63 IT-SKTTIIEPTAGNTGIALALVAIKHHLKTIFVVPEKFSTEKQQIMRALGALVINTPTS 121 T KTT+IEPT+GNTGIALA A + I +PE S E++++++ LGA ++ T + Sbjct: 74 ATPGKTTLIEPTSGNTGIALAFAAAAKGYRLILTMPETMSVERRKMLKLLGAELVLTEGA 133 Query: 122 EGISGAIKKSKELAESIPDSYLPLQFENPDNPAAYYHTLAPEIVQELGTNLTSFVAGIGS 181 +G+ GAI K+ EL E+I D+ +P QF+NP NP + T A EI + ++ VAGIG+ Sbjct: 134 KGMKGAIAKANELVETIGDAVIPGQFDNPANPEIHRRTTAEEIWNDTEGSVDILVAGIGT 193 Query: 182 GGTFAGTARYLKERIPAIRLIGVEPEGS-ILNGGEPGPHEIEGIGVEFIPPFFENLDIDG 240 GGT G + LK+R P + ++ VEP+ S IL+GG PGPH+I+GIG F P + D Sbjct: 194 GGTITGVGQVLKQRKPGVLVVAVEPKDSPILSGGNPGPHKIQGIGAGFAPAVLDTHIYDE 253 Query: 241 FETISDEEGFSYTRKLAKKNGLLVGSSSGAAFVAALKEAQRLPE--GSQVLTIFPDVADR 298 +S+E+ F+ R +A+ G+ VG SSGAA AA++ QR PE G ++ I P A+R Sbjct: 254 VVQVSNEDSFANARLVARIEGVPVGISSGAALTAAIEVGQR-PENKGKNLVVIIPSFAER 312 Query: 299 YLSKGIY 305 YLS ++ Sbjct: 313 YLSTALF 319 Lambda K H 0.316 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 324 Length adjustment: 27 Effective length of query: 279 Effective length of database: 297 Effective search space: 82863 Effective search space used: 82863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory