Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate WP_106717507.1 CU100_RS15545 tartrate dehydrogenase
Query= BRENDA::Q5SIJ1 (334 letters) >NCBI__GCF_003010935.1:WP_106717507.1 Length = 357 Score = 221 bits (562), Expect = 3e-62 Identities = 142/352 (40%), Positives = 202/352 (57%), Gaps = 24/352 (6%) Query: 3 YRICLIEGDGIGHEVIPAARRVLEATGLPLEFVEAE-----AGWETFERRGTSVPEETVE 57 Y I +IEGDGIG EVIP RVLEA F + A + + R G +PE E Sbjct: 6 YDIAVIEGDGIGKEVIPEGIRVLEAAARRHGFTLRQKWHDFAHCDYYARHGRMMPENWKE 65 Query: 58 KILSCHATLFGAATSPTRKVP---GFFGAIRYLRRRLDLYANVRPAKSR-----PVPGSR 109 +I A FGA P VP +G++ RR D Y N+RP + P+ G R Sbjct: 66 EIGKPAAIFFGAVGWPDI-VPDHISLWGSLLQFRREYDQYVNLRPVRLMDGVPCPLSGRR 124 Query: 110 PG-VDLVIVRENTEGLYVEQERRYLD-----VAIADAVISKKASERIGRAALRIAEGRPR 163 PG +D +VRENTEG Y R + + + + V+++K +RI + A +A+ RPR Sbjct: 125 PGDIDFWVVRENTEGEYSAIGGRMFEGTEREMVMQETVMTRKGVDRILKFAFDLAQTRPR 184 Query: 164 KTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDVIVTT 223 K + A K+N + +T + + V+ +A +P V+ +D V++P+ FDV+V + Sbjct: 185 KLVTSATKSNGIAITMPYWDERVEAMASSYPEVSWNKFHIDILTANFVLKPQIFDVVVGS 244 Query: 224 NLLGDILSDLAAGLVGGLGLAPSGNI---GDTTAVFEPVHGSAPDIAGKGIANPTAAILS 280 NL GDILSDL G +G+APSGNI G+ ++FEPVHGSAPDIAG+ +ANP I S Sbjct: 245 NLFGDILSDLGPACAGTIGIAPSGNINPEGEHPSLFEPVHGSAPDIAGRNLANPIGQIWS 304 Query: 281 AAMMLDYLGEKEAAKRVEKAVDLVLER-GPRTPDLGGDATTEAFTEAVVEAL 331 AAMMLD+LGEK+AA + A+++VL++ RT DLGG A T+ +A+ + L Sbjct: 305 AAMMLDHLGEKQAAADIMGAIEMVLKQPSLRTRDLGGAADTQTCGKAIADLL 356 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 357 Length adjustment: 29 Effective length of query: 305 Effective length of database: 328 Effective search space: 100040 Effective search space used: 100040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory