Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate WP_106716014.1 CU100_RS04930 aspartate aminotransferase family protein
Query= curated2:Q5JFW3 (362 letters) >NCBI__GCF_003010935.1:WP_106716014.1 Length = 401 Score = 258 bits (659), Expect = 2e-73 Identities = 154/379 (40%), Positives = 214/379 (56%), Gaps = 25/379 (6%) Query: 2 PLY----RKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIV 57 PLY R LR RGEGV+++ + G RYLD AGI VN LG++HP V + Q +K+ Sbjct: 8 PLYDTYARADLRFERGEGVWLFTDSGIRYLDFAAGIAVNSLGYSHPHLVTALKAQADKLW 67 Query: 58 VAGPMFEHDEREEMLEELSHWVDYEYVYMGNSGTEAVEAAIKFAR---LATGRSE---IV 111 ++E +E + + L + V+ NSG EA+E AIK AR G E I+ Sbjct: 68 HLSNIYEIPGQERLGQRLVDNTFADKVFFTNSGAEALECAIKTARRYHYVNGEHERFRII 127 Query: 112 AMTNAFHGRTLGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAITKETAAVIFEPI 171 AFHGRTL +++A + KY EGFGP V GF +PF +V A K AI ETAA++ EP+ Sbjct: 128 TFEGAFHGRTLATIAAGGQPKYLEGFGPKVEGFDQVPFGDVNALKAAIGPETAAILIEPV 187 Query: 172 QGEGGIVPADEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGK 230 QGEGG+ P EE ++ LR L ++ G LLI DEVQ+G+ RTGK A E G++PDI+ + K Sbjct: 188 QGEGGVRPVPEEELRALRGLCDEHGLLLILDEVQTGMGRTGKLFAHEWSGIQPDIMAVAK 247 Query: 231 GIGNGFPVSLTLTDLEIPRGK----HGSTFGGNPLACRAVATTLRILRRDRLVEKAGE-- 284 GIG GFP+ L E +G HG+T+GGNPLA L ++ + +E+ Sbjct: 248 GIGGGFPLGACLATAEAAKGMTAGVHGTTYGGNPLAMAVGNAVLDVILEEGFLERVQHVA 307 Query: 285 --------KFMEFSGERVVKTRGRGLMIGIVLRRPAGNYVKALQERGILVNTAGNRVIRL 336 + E + + RGRG +IG+ R P V+AL++ +L AG+ V+RL Sbjct: 308 LIMKQGLASISDRYPEAISEVRGRGFLIGLKCRVPNTTMVQALRDEHLLTVGAGDNVVRL 367 Query: 337 LPPLIIEGDTLEEARKEIE 355 LPPL+ + EA IE Sbjct: 368 LPPLVATEADVREALARIE 386 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 401 Length adjustment: 30 Effective length of query: 332 Effective length of database: 371 Effective search space: 123172 Effective search space used: 123172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory