Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate WP_106715672.1 CU100_RS06610 homoserine kinase
Query= reanno::Korea:Ga0059261_3253 (319 letters) >NCBI__GCF_003010935.1:WP_106715672.1 Length = 326 Score = 287 bits (734), Expect = 3e-82 Identities = 145/310 (46%), Positives = 205/310 (66%), Gaps = 2/310 (0%) Query: 1 MAVYTQVSAEALAGFLARYDVGELVSAKGIAEGVENSNYLVETTRDRFILTLYEKRVEAA 60 MAVYT ++ LA FL YD+G+L+S KGIAEGVENSNYL+ T+ +ILTLYEKRV + Sbjct: 1 MAVYTDINEIELAYFLKEYDIGDLLSYKGIAEGVENSNYLLHTSTGSYILTLYEKRVNSN 60 Query: 61 DLPYFMGLLDHLAAKGLPVPPAIKDRGGVEIQELNGRPACLIKFLSGISLSHPTPAQARA 120 DLP+F+GL+ HLA KG+ P + + G I EL GRPA ++ FL G+ + PT A Sbjct: 61 DLPFFLGLMRHLAGKGINCPLPVNRKSGSSIGELAGRPAAIVTFLEGMWMRRPTVHHCHA 120 Query: 121 AGEAMAQMHRAVADFPLDRPNSMGVDTWQPLFEKCGHSLDQIVPGLYDDLGFAIARVVPA 180 GEAMA+MH A DFP+ R N++ VD W+PL++ D++ GL ++ +A Sbjct: 121 LGEAMARMHLAGEDFPMRRRNALSVDGWRPLWDNSKAGADRVEFGLANETEADLAFFEAN 180 Query: 181 WTRNDFDRCAIHADLFPDNVLMRGDQVTGLIDFYFACTDIRVYDLAVMHSAWSFDAHGRN 240 W + IHADLFPDNV G++++GLIDFYFACTD+ YD+AV +AW F+ + Sbjct: 181 WP-SHLPSGVIHADLFPDNVFFLGNRLSGLIDFYFACTDLLAYDVAVCLNAWCFE-KDHS 238 Query: 241 YDPAVGDALIAGYEASFPLTEVERAAFPTLAAGACIRFSLSRAWDWLNTPADALVMRKDP 300 ++ G AL+ GY + L++ E A+ P LA G+ +RF L+R +DWLNTP +LV++KDP Sbjct: 239 FNLTKGAALLRGYTSVRSLSDDEAASLPILARGSALRFMLTRLYDWLNTPEGSLVVKKDP 298 Query: 301 LAYVRRLKHY 310 + Y+RR++ + Sbjct: 299 MEYIRRMRFH 308 Lambda K H 0.323 0.138 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 326 Length adjustment: 28 Effective length of query: 291 Effective length of database: 298 Effective search space: 86718 Effective search space used: 86718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
Align candidate WP_106715672.1 CU100_RS06610 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00938.hmm # target sequence database: /tmp/gapView.2758672.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00938 [M=307] Accession: TIGR00938 Description: thrB_alt: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-125 402.9 0.0 5.5e-125 402.7 0.0 1.0 1 NCBI__GCF_003010935.1:WP_106715672.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_003010935.1:WP_106715672.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 402.7 0.0 5.5e-125 5.5e-125 1 306 [. 1 306 [. 1 307 [. 0.99 Alignments for each domain: == domain 1 score: 402.7 bits; conditional E-value: 5.5e-125 TIGR00938 1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPfflellthLa 73 mavyt++ + el fL+ yd+G+lls kGiaeGvensnyll t +g+y+Ltlyekrv++++LPffl l++hLa NCBI__GCF_003010935.1:WP_106715672.1 1 MAVYTDINEIELAYFLKEYDIGDLLSYKGIAEGVENSNYLLHTSTGSYILTLYEKRVNSNDLPFFLGLMRHLA 73 9************************************************************************ PP TIGR00938 74 erglpvakpvksrdGralseLaGkPaalvefLkGssvakPtaercrevgevlaklhlagadfkeerkndlrle 146 +g+ ++ pv++++G ++eLaG+Paa+v fL+G+ +++Pt+++c++ ge +a++hlag+df+ +r+n l+ + NCBI__GCF_003010935.1:WP_106715672.1 74 GKGINCPLPVNRKSGSSIGELAGRPAAIVTFLEGMWMRRPTVHHCHALGEAMARMHLAGEDFPMRRRNALSVD 146 ************************************************************************* PP TIGR00938 147 aWsilaakkfkvleqleeelaalldkeldalkkflprdLPrgvihadlfkdnvlldgdklkgvidfyfaCeda 219 W++l + + ++ +e +la++ +++l++ + ++p +LP+gvihadlf+dnv++ g++l+g+idfyfaC+d NCBI__GCF_003010935.1:WP_106715672.1 147 GWRPLWDNSKAGADRVEFGLANETEADLAFFEANWPSHLPSGVIHADLFPDNVFFLGNRLSGLIDFYFACTDL 219 ********9999************************************************************* PP TIGR00938 220 llydlaiavndWcfeaddkldaaaakallkgyeavrpLseeekaafpvllrgaalrfllsrlldlvftqagel 292 l+yd+a+++n+Wcfe+d++++ ++ all gy +vr+Ls+ e a +p+l+rg+alrf+l+rl d+ +t+ g l NCBI__GCF_003010935.1:WP_106715672.1 220 LAYDVAVCLNAWCFEKDHSFNLTKGAALLRGYTSVRSLSDDEAASLPILARGSALRFMLTRLYDWLNTPEGSL 292 ************************************************************************* PP TIGR00938 293 vvakdPaeferkLk 306 vv kdP e+ r+++ NCBI__GCF_003010935.1:WP_106715672.1 293 VVKKDPMEYIRRMR 306 ***********987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (326 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 20.16 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory