Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_106716758.1 CU100_RS11830 hydroxyectoine utilization dehydratase EutB
Query= BRENDA::P9WG59 (360 letters) >NCBI__GCF_003010935.1:WP_106716758.1 Length = 333 Score = 72.4 bits (176), Expect = 2e-17 Identities = 88/304 (28%), Positives = 135/304 (44%), Gaps = 18/304 (5%) Query: 35 LEG---GTPLIAATNLSKQTGCTIHLKVEGLNPTGSFKDRGMTMAVTD-ALAHGQRAVLC 90 LEG TP++ +++LS++ G ++LK+E TGSFK RG T A++ + A QR V+ Sbjct: 18 LEGKIVATPMVHSSSLSEKFGQPVYLKLEHRQTTGSFKLRGATNALSHLSAAEKQRGVIA 77 Query: 91 ASTGNTSASAAAYAARAGITCAVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELAR 150 ASTGN A AYAAR AV+ + K+A+ GA I I + DD E Sbjct: 78 ASTGN-HGRALAYAARLEGIRAVICMSRLVPENKIAEISRLGADIRIIGKSQDDAQEEVD 136 Query: 151 KMAADFPTISLVNSVNPVRIEGQKTAAFEIVDVLGTAPDVHALPVGNAGNITAYWKGYTE 210 ++ + I L + I GQ T EI++ D+ A+ V +G A Sbjct: 137 RLVREAGLIMLPPFDDAAIIAGQGTLGLEIIE---DVEDLEAVLVPVSGGGLASGVAAAI 193 Query: 211 YHQLGLIDKLPRMLGTQAAGAAPLVLGEP--VSHPETIATAI--RIGSPASWTSAVEAQQ 266 + + + AA A L G+P V E++A ++ IG +T A+ + Sbjct: 194 KARRPATKIIGVSMDRGAAMRASLDAGKPVIVEESESLADSLGGGIGLENQFTFAM--VR 251 Query: 267 QSKGRFLAASDEEILAAYHLVARVEGVFVEPASAASIAGLLKAIDDGWVARGSTVVCTVT 326 + S++EI A E +E A+A I LL G V VV ++ Sbjct: 252 DLLDDVILLSEDEIAAGMAHAYMQEREVIEGAAAVGIGALLA----GKVQARGPVVAVLS 307 Query: 327 GNGL 330 G + Sbjct: 308 GRNV 311 Lambda K H 0.317 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 333 Length adjustment: 29 Effective length of query: 331 Effective length of database: 304 Effective search space: 100624 Effective search space used: 100624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory