Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_106713095.1 CU102_RS21190 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_003010955.1:WP_106713095.1 Length = 432 Score = 217 bits (552), Expect = 1e-60 Identities = 139/407 (34%), Positives = 211/407 (51%), Gaps = 17/407 (4%) Query: 388 VNPIIENVRDKGNSALLEYTEKFDGVKLSNPVLNAPFPEEYFEGLTEEMKEALDLSIENV 447 V II NVR +G++A+ +Y+ +D + + E L + ++ + +IE V Sbjct: 33 VKDIIANVRAQGDAAVRKYSRTYDRADIEAFEVGLEDRLEAVANLDPQTRKDTEFAIERV 92 Query: 448 RKFHAAQLPTET-LEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALMLGVPAQVAQ 506 ++F AQL T LE + PG+ PIE VG Y+PGG + S +M VPA+VA Sbjct: 93 KEFAEAQLRTILPLEFDALPGLHLGHRIIPIEVVGAYVPGGRYPILSAPVMTIVPAKVAG 152 Query: 507 CKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTETIPKVDKILG 566 C +++ PP P ++ GA +I GGAQA+AAMA+GTETIP VDKI+G Sbjct: 153 CDQVIACLPPN-----AHPAMIAGCHLSGADRIFKVGGAQAIAAMAFGTETIPAVDKIVG 207 Query: 567 PGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQAEHGIDSQ 626 PGN +V AK V ID AGPSE+ V+ADE D + +A+DLL+QAEH + ++ Sbjct: 208 PGNAYVNEAKRQVFGQV----GIDQLAGPSEIFVVADESGDAEMIATDLLAQAEHDVRTR 263 Query: 627 VILVGVN--LSEKKIQEIQDAVHNQALQLPRVDIVRKCIA-HSTIVLCDGYEEALEMSNQ 683 V L+ + L+E ++E++ Q LP D+ + I +C ++ S+ Sbjct: 264 VGLITTDQKLAEATLKEVE----RQLETLPTADVAGVAWRDYGEIAVCADESAMIQYSDH 319 Query: 684 YAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQYSGAN 743 A EHL + + + + N GS+F+G D GTNHTLPT AR G Sbjct: 320 IAAEHLEVHTRDPHSTAGKLRNYGSLFIGKLASVVYSDKCCGTNHTLPTMAAARYTGGLW 379 Query: 744 TATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIRMSK 790 ++ K T Q + G+ + + ++ EG++GHR A R+S+ Sbjct: 380 VGSYVKVCTHQWLDERGVAAVAPPSVRQSRTEGMEGHRRAAAFRLSQ 426 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 642 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 432 Length adjustment: 37 Effective length of query: 762 Effective length of database: 395 Effective search space: 300990 Effective search space used: 300990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory