Align Methionine synthase component, B12 binding and B12-binding cap domains (EC:2.1.1.13) (characterized)
to candidate WP_106713177.1 CU102_RS21440 methionine synthase
Query= reanno::Phaeo:GFF1319 (233 letters) >NCBI__GCF_003010955.1:WP_106713177.1 Length = 1262 Score = 98.2 bits (243), Expect = 7e-25 Identities = 67/217 (30%), Positives = 112/217 (51%), Gaps = 21/217 (9%) Query: 26 LYDGLKEEIEESVNILLERGWAPYKVLTEALVGGMTIVGADFRDGILFVPEVLLAANAMK 85 L +G+ E IE P V+ L+ GM +VG F G +F+P+V+ +A MK Sbjct: 686 LVNGITEFIEADTEEARLEAERPLHVIEGPLMAGMNVVGDLFGAGKMFLPQVVKSARVMK 745 Query: 86 GGMAILKPL-----LAETGAPRM---GSMVIGTVKGDIHDIGKNLVSMMMEGAGFEVVDI 137 +A+L P LA G+ + G +++ TVKGD+HDIGKN+V +++ +E++D+ Sbjct: 746 QAVAVLLPYMEAEKLANGGSGQRESAGKVLMATVKGDVHDIGKNIVGVVLACNNYEIIDL 805 Query: 138 GINNPVENYLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIEQGKRDDYIVLVGGA--- 194 G+ P L+ + + DI+G+S L+T ++ M V M +G D +L+GGA Sbjct: 806 GVMVPSAKILQTARDEKVDIIGLSGLITPSLDEMVHVAAEMEREG--FDIPLLIGGATTS 863 Query: 195 ------PLNEEFGKAIGADGYCRDAAVAVEMAKDFVA 225 +N + K G Y DA+ AV + + ++ Sbjct: 864 RVHTAVKINPRYHK--GQTVYVTDASRAVGVVSNLLS 898 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 606 Number of extensions: 36 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 1262 Length adjustment: 35 Effective length of query: 198 Effective length of database: 1227 Effective search space: 242946 Effective search space used: 242946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory