Align Predicted argE by GapMind curators (no experimental data)
to candidate WP_106711061.1 CU102_RS09815 amidohydrolase
Query= predicted:W3Y6L2 (394 letters) >NCBI__GCF_003010955.1:WP_106711061.1 Length = 387 Score = 268 bits (686), Expect = 2e-76 Identities = 147/384 (38%), Positives = 228/384 (59%), Gaps = 9/384 (2%) Query: 12 ASQYKEQVVAWRRHIHSHPELSGEEKETSAFIQSVLTDLGIP-FKADVYKYAVIGEIKGA 70 A + ++ V WR H+H +PE+ + +TSAF+ L + G + + + V+G ++G Sbjct: 7 AHEMQQHVAEWRHHLHENPEILYDVHQTSAFVAEKLREFGCDTIETGIGQTGVVGLVRGR 66 Query: 71 F-DGPVVGLRADMDALPITEVTGLPFTSENPGVMHACGHDSHMAILLGAAAILQSVKDQL 129 +GPV+G RADMDALPITE +G P+ S+ G MHACGHD H A+LLGAA L ++ Sbjct: 67 HGEGPVIGFRADMDALPITEASGKPWASKTLGKMHACGHDGHTAMLLGAAQYLAETRN-F 125 Query: 130 HGTVKLVIQPAEEEALIKGAQGIVDSGVLDD--VDEIYGLHVWPQLPVGTVGLKKGNLMA 187 GT+ L+ QPAEE GA+ ++D G++D + E+YG+H P LPVG +KG++MA Sbjct: 126 RGTIVLIFQPAEEGGA--GARAMIDDGLMDRFAIGEVYGMHNAPGLPVGQFATRKGSIMA 183 Query: 188 ASDRFLVHIKGKATHGAEPHNGIDAIVAAANWIVNVESMVARETNPMDNLVCTIGVFNSG 247 A++ F + + G++ H A+PH ID +V +A+ I+ ++S+V+RET+P+ LV ++ N G Sbjct: 184 ATNEFEITVTGRSGHAAKPHTAIDPVVISAHIILALQSIVSRETDPLKALVVSVTQLNGG 243 Query: 248 DRYNVGSGDAYLEGTCRTYDPAKRDYIERRLGESLKALDMMFGTTSTLEYRRGHGATIND 307 D NV L GT RT P R++ ++RL E +++ +FG + + Y +G+ T N Sbjct: 244 DATNVIPDVIKLGGTVRTLVPEIREFAQKRLTEIVESTAAVFGGKAEVVYHQGYPVTFNH 303 Query: 308 ADAIDYVTHIVKTYLGKDAVVHPEFPSMAAEDFSAYLNKIKGAFLWLGTGFEGNPALHNA 367 D+ I +T +G+ AV P M AEDFS L GAF++LG G P LHN+ Sbjct: 304 DRETDFAIGIAQTIVGEAAVNTTMPPVMGAEDFSYMLESRPGAFVFLGNG--DTPGLHNS 361 Query: 368 AFTIDESILEPGITMMAGIAAELL 391 A+ ++ + GI+ +A L Sbjct: 362 AYDFNDDAIPYGISYWVSLAETAL 385 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 387 Length adjustment: 31 Effective length of query: 363 Effective length of database: 356 Effective search space: 129228 Effective search space used: 129228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory