Align Phosphoserine phosphatase 1; PSP 1; PSPase 1; Metal-independent phosphoserine phosphatase 1; iPSP1; O-phosphoserine phosphohydrolase 1; EC 3.1.3.3 (characterized)
to candidate WP_106712461.1 CU102_RS17875 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Query= SwissProt::D3DFG8 (211 letters) >NCBI__GCF_003010955.1:WP_106712461.1 Length = 206 Score = 73.6 bits (179), Expect = 3e-18 Identities = 57/168 (33%), Positives = 84/168 (50%), Gaps = 7/168 (4%) Query: 4 LILVRHAESEWNPVGRYQGLLDPDLSERGKKQAKLLAQELSREHL--DVIYSSPLKRTYL 61 L+LVRH +SEWN + G DP L+E G K+A + L + L D+ Y+S L R Sbjct: 5 LVLVRHGQSEWNLKNLFTGWRDPGLTELGHKEAIDAGKRLKAKGLSFDIAYTSVLSRAQA 64 Query: 62 TALEIAE---AKNLEVIKEDRIIEIDHGMWSGMLVEEVMEKYPEDFRRWVEEPHKVEFQG 118 T I E LE I++ + E D+G SG+ ++ K+ E+ + V G Sbjct: 65 TLEHILEEVGQTGLETIRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDVSPPG 124 Query: 119 GESLASVYNRV-KGFLEEVRKRHW-NQTVVVVSHTVPMRAMYCALLGV 164 GESL RV +L EV+ +TV+V +H +RA+ AL G+ Sbjct: 125 GESLRDTGARVWPYYLHEVQPHVLRGETVLVAAHGNSLRALIMALDGL 172 Lambda K H 0.320 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 206 Length adjustment: 21 Effective length of query: 190 Effective length of database: 185 Effective search space: 35150 Effective search space used: 35150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory