GapMind for Amino acid biosynthesis

 

Alignments for a candidate for serB in Phyllobacterium brassicacearum STM 196

Align Phosphoserine phosphatase; PSP; EC 3.1.3.3 (characterized)
to candidate WP_106713723.1 CU102_RS24620 haloacid dehalogenase type II

Query= SwissProt::Q72H00
         (249 letters)



>NCBI__GCF_003010955.1:WP_106713723.1
          Length = 229

 Score = 62.0 bits (149), Expect = 1e-14
 Identities = 40/123 (32%), Positives = 60/123 (48%), Gaps = 2/123 (1%)

Query: 122 YPEAEAFLAEARRRGLALALLTNGVPDLQREKLVGAGLAHHFSLVLISGEVGIGKPDPRL 181
           +P+  A L   ++ G+  A+LTNG P++       AG+   F  +L   EV I KP P +
Sbjct: 101 FPDVAATLKVLKQAGIKTAILTNGTPEMIAAACSNAGIDGFFDAILSVDEVQIYKPHPSV 160

Query: 182 FRMALCAFGVAPEEAAMVGDNPQKDVRGARLAGVRAVWVDRGLRPEDP-EASPDLRVGDL 240
           +++A+   G A E  +    N   D  GA   G R VW +R  +P D   A PD  +  L
Sbjct: 161 YQLAVDRLGAAKERISFQSSNCW-DAIGASHFGFRVVWCNRYDQPLDQLSAKPDAVIKSL 219

Query: 241 REV 243
            E+
Sbjct: 220 AEL 222


Lambda     K      H
   0.322    0.140    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 133
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 249
Length of database: 229
Length adjustment: 23
Effective length of query: 226
Effective length of database: 206
Effective search space:    46556
Effective search space used:    46556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory