Align Phosphoserine phosphatase; PSP; EC 3.1.3.3 (characterized)
to candidate WP_106713723.1 CU102_RS24620 haloacid dehalogenase type II
Query= SwissProt::Q72H00 (249 letters) >NCBI__GCF_003010955.1:WP_106713723.1 Length = 229 Score = 62.0 bits (149), Expect = 1e-14 Identities = 40/123 (32%), Positives = 60/123 (48%), Gaps = 2/123 (1%) Query: 122 YPEAEAFLAEARRRGLALALLTNGVPDLQREKLVGAGLAHHFSLVLISGEVGIGKPDPRL 181 +P+ A L ++ G+ A+LTNG P++ AG+ F +L EV I KP P + Sbjct: 101 FPDVAATLKVLKQAGIKTAILTNGTPEMIAAACSNAGIDGFFDAILSVDEVQIYKPHPSV 160 Query: 182 FRMALCAFGVAPEEAAMVGDNPQKDVRGARLAGVRAVWVDRGLRPEDP-EASPDLRVGDL 240 +++A+ G A E + N D GA G R VW +R +P D A PD + L Sbjct: 161 YQLAVDRLGAAKERISFQSSNCW-DAIGASHFGFRVVWCNRYDQPLDQLSAKPDAVIKSL 219 Query: 241 REV 243 E+ Sbjct: 220 AEL 222 Lambda K H 0.322 0.140 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 229 Length adjustment: 23 Effective length of query: 226 Effective length of database: 206 Effective search space: 46556 Effective search space used: 46556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory