Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate WP_066329651.1 BLR17_RS09620 shikimate dehydrogenase
Query= reanno::Btheta:353741 (248 letters) >NCBI__GCF_900100165.1:WP_066329651.1 Length = 249 Score = 254 bits (650), Expect = 9e-73 Identities = 127/248 (51%), Positives = 173/248 (69%), Gaps = 6/248 (2%) Query: 2 EKYGLIGYPLRHSFSIGYFNEKFRSEGI-NAEYVNFEIPNINDFMEVIEENPNLCGLNVT 60 +++GL+G + +SFS G+F KF E + N Y NF+I I+ F E+I+ +L GLNVT Sbjct: 7 KRFGLLGRNISYSFSKGHFTTKFEKEKLQNYTYENFDIQEISAFPEIIKNTDHLSGLNVT 66 Query: 61 IPYKEQVIPFLNELDRDTAKIGAVNVIKIIRQPKGKVKLVGYNSDIIGFTQSIQPLLQPQ 120 IPYKE VIP+L++L + KIGAVN IK + KGK+K GYN+D GF +S++PLL+P Sbjct: 67 IPYKEDVIPYLDKLSKKAKKIGAVNTIKFTK--KGKLK--GYNTDYFGFLKSLEPLLKPH 122 Query: 121 HKKALILGTGGASKAVYHGLKNLGIESVFVSRTHKTDDMLTYEELTPEIMEEYTVIVNCT 180 HKKALILGTGGASK V L+ LGIE +FVSR ++ + Y ++ E +EY +I+N T Sbjct: 123 HKKALILGTGGASKGVAFALEELGIEYLFVSRK-ASEKAIDYSQINTETFKEYQIIINST 181 Query: 181 PVGMYPKVDFCPNIPYELLTPNHLLYDLLYNPNVTLFMKKGEAQGAVTKNGLEMLLLQAF 240 P+G P ++ CP IPYEL T H+ YDL+YNP T F+K +A+GA KNGL+ML+ QA Sbjct: 182 PIGTSPNIEACPEIPYELFTDKHIAYDLIYNPAETQFLKNAKARGAQIKNGLDMLIFQAE 241 Query: 241 AAWEIWHR 248 AWEIW++ Sbjct: 242 KAWEIWNK 249 Lambda K H 0.320 0.140 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 249 Length adjustment: 24 Effective length of query: 224 Effective length of database: 225 Effective search space: 50400 Effective search space used: 50400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory