Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate WP_066326070.1 BLR17_RS13985 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
Query= metacyc::HISTCYCLOPRATPPHOS (203 letters) >NCBI__GCF_900100165.1:WP_066326070.1 Length = 199 Score = 189 bits (481), Expect = 2e-53 Identities = 99/198 (50%), Positives = 135/198 (68%), Gaps = 3/198 (1%) Query: 9 ELDWEKT-DGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGET 67 E+D+ K+ GL+P I+Q + + VLMLGYMN EA KT+E+GKVTFFSR+KQRLWTKGE Sbjct: 2 EIDFSKSAHGLIPAIIQDSETKNVLMLGYMNDEAYQKTIETGKVTFFSRSKQRLWTKGEE 61 Query: 68 SGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCF-GDTAHQWLFLYQLEQLL-AER 125 SG+FLN+V I DCD DTLL+ A P+GPTCH G +C+ + + F+ +LE + + R Sbjct: 62 SGHFLNLVDIKNDCDGDTLLIQAVPVGPTCHTGADTCWQTQNKNSYGFISELENTIQSRR 121 Query: 126 KSADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHLLVLLQ 185 + AD E SY A L+A G +IAQKVGEE VE + A + +E++DL++H L+LLQ Sbjct: 122 EKADSEQSYVASLFAKGINKIAQKVGEEAVEVVIEAKDANDNLFLSESADLLFHYLILLQ 181 Query: 186 DQGLDLTTVIENLRKRHQ 203 +G L VI L+ R + Sbjct: 182 AKGYKLDDVINVLKSRQK 199 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 199 Length adjustment: 21 Effective length of query: 182 Effective length of database: 178 Effective search space: 32396 Effective search space used: 32396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
Align candidate WP_066326070.1 BLR17_RS13985 (bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE)
to HMM PF01502 (PRA-CH)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF01502.22.hmm # target sequence database: /tmp/gapView.3071654.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: PRA-CH [M=74] Accession: PF01502.22 Description: Phosphoribosyl-AMP cyclohydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-37 114.1 0.0 2e-37 113.2 0.0 1.5 1 NCBI__GCF_900100165.1:WP_066326070.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900100165.1:WP_066326070.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.2 0.0 2e-37 2e-37 1 74 [] 27 100 .. 27 100 .. 0.99 Alignments for each domain: == domain 1 score: 113.2 bits; conditional E-value: 2e-37 PRA-CH 1 mlaymneealektletgkavyySrsrqklwkkGetsgnvqkvkeirldcDeDalllkveqkgaaCHtgersCF 73 ml+ymn+ea++kt+etgk++++Srs+q+lw+kGe+sg+++++++i+ dcD+D+ll+++ + g++CHtg+++C+ NCBI__GCF_900100165.1:WP_066326070.1 27 MLGYMNDEAYQKTIETGKVTFFSRSKQRLWTKGEESGHFLNLVDIKNDCDGDTLLIQAVPVGPTCHTGADTCW 99 9***********************************************************************9 PP PRA-CH 74 y 74 + NCBI__GCF_900100165.1:WP_066326070.1 100 Q 100 5 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (74 nodes) Target sequences: 1 (199 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.62 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory