Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_066326841.1 BLR17_RS05750 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_900100165.1:WP_066326841.1 Length = 396 Score = 230 bits (586), Expect = 6e-65 Identities = 142/368 (38%), Positives = 218/368 (59%), Gaps = 17/368 (4%) Query: 23 LVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGYLELRQAVQLYMKKKA 82 L AQ +D+ISL++G+PDF TP +K AAKKAIDEN ++Y+P GY EL+ A+ K+ Sbjct: 27 LKAQGKDIISLSLGEPDFNTPDFIKEAAKKAIDENYSTYSPVDGYAELKDAICRKFKRDN 86 Query: 83 DFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPVIVDT 142 +Y S+I+++TGA Q++ + +L+ GDEVI+P P + Y I+ L G PV V T Sbjct: 87 GLDY-KPSQIVVSTGAKQSLYNIAQVMLNDGDEVILPAPYWVSYFEIVKLSGGVPVEVPT 145 Query: 143 T-SHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIAALL-KGRNVFVLSD 200 + FK+T +E A+TP TK + P NP+G + EEL ++A +L K N++V++D Sbjct: 146 SVETDFKITPEQLEAAITPKTKMMWFSSPCNPSGSVYNREELTALAKVLEKYPNIYVVAD 205 Query: 201 EIYSELTYDRPHYSIATY--LRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKHILKVHQ 258 EIY + + SIA+ + ++T+ +NG++K+ +MTG+RIG++ AP+ IAK K+ Sbjct: 206 EIYEHINFSGTFCSIASIPGMFERTVTVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQG 265 Query: 259 YNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYDRLVSM-GLDVVKPSGAFYI 317 S A+SI+Q+A + AV M + + R D V L + G+ + P GAFY+ Sbjct: 266 QVTSGANSIAQRATITAVDADPSVLNHMVQAFHSRRDLVVGLLKEIPGIKINVPEGAFYV 325 Query: 318 FPSIKS-FGMT--------SFDFSMALLEDAGVALVPGSSFSTYGEGYVRLSFACSMDTL 368 FP + S FG T + D SM LL +A VA V G +F +R S+A S + L Sbjct: 326 FPDVSSFFGKTLKGTEIKDANDVSMYLLAEANVATVTGDAFG--NPNCIRFSYATSDELL 383 Query: 369 REGLDRLE 376 +E L R++ Sbjct: 384 KEALKRIK 391 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 396 Length adjustment: 31 Effective length of query: 362 Effective length of database: 365 Effective search space: 132130 Effective search space used: 132130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory