Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_066325809.1 BLR17_RS15165 ornithine--oxo-acid transaminase
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_900100165.1:WP_066325809.1 Length = 416 Score = 166 bits (421), Expect = 9e-46 Identities = 122/412 (29%), Positives = 187/412 (45%), Gaps = 44/412 (10%) Query: 15 PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAI--QAQATRLTHYAFNAA 72 P+ L G VWD DGK+Y DF+ +N GHC+P +V A+ QAQ LT AF Sbjct: 31 PVVLEKGEGVFVWDVDGKKYYDFLSAYSAVNQGHCHPKIVGAMVQQAQKLALTSRAFYND 90 Query: 73 PHGPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGAT--------GKRAIIA 124 G Y + + F V + N+GAEA E ALK+ R + II Sbjct: 91 QLGVYEEYVTKYFGFDKV------LPMNTGAEAVETALKLCRKWAYEVKKIHENQAQIIV 144 Query: 125 FDGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSV 184 + FHGRT ++ + K G + Y + +D L V Sbjct: 145 CENNFHGRTTTIISFSNDETARKS-FGPFTEGFIKIEYDN-------------LDALEKV 190 Query: 185 ELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFA 244 + +++A F+ EP+QGE G + + C++ +L I DE+Q+G RTG+ A Sbjct: 191 LESSKNIAGFLVEPIQGEAGVYVPSEGYLAKAKALCEKHNVLFIADEVQTGIARTGKLLA 250 Query: 245 FPRLGIEPDLLLLAKSIAGGM-PLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASL 303 ++PD+L+L K+++GG+ P+ AV+ +M + G G T+ GNP++ A A+A+L Sbjct: 251 VQHENVQPDILILGKALSGGVYPVSAVLANNAIMNVIKPGQHGSTFGGNPVAAAVAIAAL 310 Query: 304 AQMTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANA---DGSPA 360 + DE LA ER + + GL+ R + +RG NA D Sbjct: 311 DVIKDEKLAENAERLGEIL--------RDGLNAIASRNPLISLVRGKGLLNAIVIDCDEE 362 Query: 361 PAQLAKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCL 412 + R GLL P+ + IRL PL I +++ L I+E+ L Sbjct: 363 SDLAWNICLKFRDYGLLAKPTHGNK--IRLAPPLVITENQIQDCLSIIEKAL 412 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 416 Length adjustment: 31 Effective length of query: 385 Effective length of database: 385 Effective search space: 148225 Effective search space used: 148225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory