Align prephenate and/or arogenate dehydratase (EC 4.2.1.51) (characterized)
to candidate WP_066328698.1 BLR17_RS00155 prephenate dehydratase
Query= reanno::Cola:Echvi_0123 (279 letters) >NCBI__GCF_900100165.1:WP_066328698.1 Length = 278 Score = 290 bits (743), Expect = 2e-83 Identities = 145/273 (53%), Positives = 194/273 (71%) Query: 7 QQKVAIQGIKGSYHYQVALNQFGQDIHVIECLTFSDLVKSITSNDADIGVLALENSIAGA 66 + K+AIQGI GS+H+QVA +G+++ V EC++F +LV S+ S + V+A+ENSIAG Sbjct: 2 ETKIAIQGILGSFHHQVAQEYYGKEVVVDECMSFEELVDSLLSGKSSQAVMAIENSIAGP 61 Query: 67 ILPNYDLMDRNNLQVIGEFYLPISHQLMVLKGQSIDDITEVRSHPMALLQCKAFFEQYPQ 126 I+PNY L+D+N L +IGE YL I LM LKGQ I+DITEV SHPMALLQC F ++YP Sbjct: 62 IIPNYALIDKNKLHIIGEHYLSIHQNLMALKGQKIEDITEVYSHPMALLQCMDFLKKYPH 121 Query: 127 IKLIEDLDTASVAKEISEQHLQGVGAIAGKSAAEFYGLDILASDIQTIKNNITRFCIVKN 186 IKL+ED DTA A+ I E+ L+G+ AIA K+AAE Y L+ILA +IQTIKNN+TRF I++ Sbjct: 122 IKLVEDKDTAETARRIQEKQLKGIAAIASKTAAEMYDLEILAPEIQTIKNNMTRFVIIQK 181 Query: 187 AADAKPVIGFDKASIKVTIKNEQGSLAKVLTTMSAYRLDLTKIQSLPVIDQPWHYAFFID 246 ++AS+K + +++GSLA VL MS +++LTKIQSLP I+ PW Y+FF+D Sbjct: 182 ENSFVSEEEINRASLKFELDHKRGSLAAVLNVMSDCKMNLTKIQSLPKIETPWKYSFFVD 241 Query: 247 LLFENLEDYQQALKELKANGHQIKVLGEYKNTK 279 + FE EDY +A L+ KVLGEY NTK Sbjct: 242 VTFEKYEDYAKAKSLLEIMAEYFKVLGEYTNTK 274 Lambda K H 0.319 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 278 Length adjustment: 25 Effective length of query: 254 Effective length of database: 253 Effective search space: 64262 Effective search space used: 64262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory